Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 47001..47708 | Replicon | chromosome |
Accession | NZ_CP107077 | ||
Organism | Kosakonia cowanii strain LT-1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | ODS25_RS00230 | Protein ID | WP_124966952.1 |
Coordinates | 47403..47708 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | ODS25_RS00225 | Protein ID | WP_042715055.1 |
Coordinates | 47001..47402 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ODS25_RS00205 | 42778..43725 | + | 948 | WP_200135116.1 | ABC transporter permease | - |
ODS25_RS00210 | 43722..44705 | + | 984 | WP_263753641.1 | ABC transporter ATP-binding protein | - |
ODS25_RS00215 | 44702..45676 | + | 975 | WP_054802734.1 | ATP-binding cassette domain-containing protein | - |
ODS25_RS00220 | 45750..46943 | + | 1194 | WP_042715056.1 | zinc-dependent alcohol dehydrogenase | - |
ODS25_RS00225 | 47001..47402 | - | 402 | WP_042715055.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
ODS25_RS00230 | 47403..47708 | - | 306 | WP_124966952.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
ODS25_RS00235 | 47865..48518 | - | 654 | WP_263753643.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
ODS25_RS00240 | 48713..49648 | + | 936 | WP_263754789.1 | LysR family transcriptional regulator | - |
ODS25_RS00245 | 49710..50663 | + | 954 | WP_263753644.1 | aldo/keto reductase | - |
ODS25_RS00250 | 50770..51942 | - | 1173 | WP_263753645.1 | multidrug effflux MFS transporter | - |
ODS25_RS00255 | 52050..52652 | - | 603 | WP_263753646.1 | XRE family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11560.57 Da Isoelectric Point: 8.9492
>T260506 WP_124966952.1 NZ_CP107077:c47708-47403 [Kosakonia cowanii]
MEKGTPHVRLHIVKRMVLEGKVRTTASAVAGAIELGFNPPPFDEMCAVILALTSEDFFKSMTAYADHTVWHDVYRPVWKR
QKLYLKLIVSDDVLIVSFKER
MEKGTPHVRLHIVKRMVLEGKVRTTASAVAGAIELGFNPPPFDEMCAVILALTSEDFFKSMTAYADHTVWHDVYRPVWKR
QKLYLKLIVSDDVLIVSFKER
Download Length: 306 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14947.15 Da Isoelectric Point: 8.4858
>AT260506 WP_042715055.1 NZ_CP107077:c47402-47001 [Kosakonia cowanii]
MKCPVCGAAGLKHDTRNIEYRYKGKVTTLTAIAGEYCDACGEIIFDRLNGEHYSKQVAAFVRKVNAEEVDPQFIATIRKR
FNLDQRQAAEMFGGGANAFSRYETGRVAPPRPLVLLFKALDKHPELFEELKHA
MKCPVCGAAGLKHDTRNIEYRYKGKVTTLTAIAGEYCDACGEIIFDRLNGEHYSKQVAAFVRKVNAEEVDPQFIATIRKR
FNLDQRQAAEMFGGGANAFSRYETGRVAPPRPLVLLFKALDKHPELFEELKHA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|