Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 6094606..6095381 | Replicon | chromosome |
| Accession | NZ_CP107064 | ||
| Organism | Pseudomonas aeruginosa strain PALA20 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V6ADY6 |
| Locus tag | PALA20_RS28685 | Protein ID | WP_009518525.1 |
| Coordinates | 6094606..6095064 (-) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | V6AEP7 |
| Locus tag | PALA20_RS28690 | Protein ID | WP_023098543.1 |
| Coordinates | 6095064..6095381 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA20_RS28660 (PALA20_05665) | 6089947..6090894 | + | 948 | WP_009518520.1 | TIGR03756 family integrating conjugative element protein | - |
| PALA20_RS28665 (PALA20_05666) | 6090904..6092298 | + | 1395 | WP_227337149.1 | integrating conjugative element protein | - |
| PALA20_RS28670 (PALA20_05667) | 6092295..6092654 | + | 360 | WP_009518522.1 | hypothetical protein | - |
| PALA20_RS28675 (PALA20_05668) | 6092669..6094186 | + | 1518 | WP_009518523.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| PALA20_RS28680 (PALA20_05669) | 6094202..6094579 | - | 378 | WP_009518524.1 | DUF3742 family protein | - |
| PALA20_RS28685 (PALA20_05670) | 6094606..6095064 | - | 459 | WP_009518525.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| PALA20_RS28690 (PALA20_05671) | 6095064..6095381 | - | 318 | WP_023098543.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| PALA20_RS28695 (PALA20_05672) | 6095681..6097498 | + | 1818 | WP_023098542.1 | MobH family relaxase | - |
| PALA20_RS28700 (PALA20_05673) | 6097480..6097626 | - | 147 | WP_023098541.1 | MerR family DNA-binding transcriptional regulator | - |
| PALA20_RS28705 (PALA20_05674) | 6097775..6098686 | - | 912 | WP_023098540.1 | NAD(P)H-binding protein | - |
| PALA20_RS28710 (PALA20_05675) | 6098823..6100208 | + | 1386 | Protein_5674 | efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 6037524..6165828 | 128304 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17660.02 Da Isoelectric Point: 10.1848
>T260504 WP_009518525.1 NZ_CP107064:c6095064-6094606 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|