Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2718166..2718761 | Replicon | chromosome |
| Accession | NZ_CP107064 | ||
| Organism | Pseudomonas aeruginosa strain PALA20 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA20_RS12855 | Protein ID | WP_003113526.1 |
| Coordinates | 2718166..2718444 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA20_RS12860 | Protein ID | WP_003133769.1 |
| Coordinates | 2718456..2718761 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA20_RS12835 (PALA20_02539) | 2713591..2714829 | + | 1239 | WP_003095023.1 | C69 family dipeptidase | - |
| PALA20_RS12840 (PALA20_02540) | 2714891..2715538 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA20_RS12845 (PALA20_02541) | 2715609..2717837 | - | 2229 | WP_023104079.1 | TonB-dependent receptor | - |
| PALA20_RS12850 | 2717985..2718113 | + | 129 | Protein_2538 | integrase | - |
| PALA20_RS12855 | 2718166..2718444 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA20_RS12860 (PALA20_02542) | 2718456..2718761 | + | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA20_RS12870 (PALA20_02544) | 2719433..2720575 | + | 1143 | WP_023098851.1 | STY4528 family pathogenicity island replication protein | - |
| PALA20_RS12875 (PALA20_02545) | 2721176..2722039 | + | 864 | WP_023098850.1 | integrase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T260500 WP_003113526.1 NZ_CP107064:2718166-2718444 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|