Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 61761..62025 Replicon plasmid pMJ4-2
Accession NZ_CP107045
Organism Klebsiella pneumoniae strain KPTA-2108

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag OEC00_RS27185 Protein ID WP_001331364.1
Coordinates 61761..61913 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 61963..62025 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEC00_RS27155 (57029) 57029..59197 + 2169 WP_263598975.1 DotA/TraY family protein -
OEC00_RS27160 (59268) 59268..59930 + 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
OEC00_RS27165 (60002) 60002..60211 - 210 WP_039025903.1 HEAT repeat domain-containing protein -
OEC00_RS27170 (60603) 60603..60779 + 177 WP_001054897.1 hypothetical protein -
OEC00_RS27175 (60844) 60844..61076 - 233 Protein_64 hypothetical protein -
OEC00_RS27180 (61438) 61438..61689 + 252 WP_001291964.1 hypothetical protein -
OEC00_RS27185 (61761) 61761..61913 - 153 WP_001331364.1 Hok/Gef family protein Toxin
- (61963) 61963..62025 + 63 NuclAT_0 - Antitoxin
- (61963) 61963..62025 + 63 NuclAT_0 - Antitoxin
- (61963) 61963..62025 + 63 NuclAT_0 - Antitoxin
- (61963) 61963..62025 + 63 NuclAT_0 - Antitoxin
OEC00_RS27190 (62205) 62205..63413 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
OEC00_RS27195 (63432) 63432..64502 + 1071 WP_263598976.1 IncI1-type conjugal transfer protein TrbB -
OEC00_RS27200 (64495) 64495..66786 + 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..98026 98026


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T260493 WP_001331364.1 NZ_CP107045:c61913-61761 [Klebsiella pneumoniae]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT260493 NZ_CP107045:61963-62025 [Klebsiella pneumoniae]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References