Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 61761..62025 | Replicon | plasmid pMJ4-2 |
| Accession | NZ_CP107045 | ||
| Organism | Klebsiella pneumoniae strain KPTA-2108 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | OEC00_RS27185 | Protein ID | WP_001331364.1 |
| Coordinates | 61761..61913 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 61963..62025 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEC00_RS27155 (57029) | 57029..59197 | + | 2169 | WP_263598975.1 | DotA/TraY family protein | - |
| OEC00_RS27160 (59268) | 59268..59930 | + | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| OEC00_RS27165 (60002) | 60002..60211 | - | 210 | WP_039025903.1 | HEAT repeat domain-containing protein | - |
| OEC00_RS27170 (60603) | 60603..60779 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| OEC00_RS27175 (60844) | 60844..61076 | - | 233 | Protein_64 | hypothetical protein | - |
| OEC00_RS27180 (61438) | 61438..61689 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| OEC00_RS27185 (61761) | 61761..61913 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (61963) | 61963..62025 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (61963) | 61963..62025 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (61963) | 61963..62025 | + | 63 | NuclAT_0 | - | Antitoxin |
| - (61963) | 61963..62025 | + | 63 | NuclAT_0 | - | Antitoxin |
| OEC00_RS27190 (62205) | 62205..63413 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| OEC00_RS27195 (63432) | 63432..64502 | + | 1071 | WP_263598976.1 | IncI1-type conjugal transfer protein TrbB | - |
| OEC00_RS27200 (64495) | 64495..66786 | + | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..98026 | 98026 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T260493 WP_001331364.1 NZ_CP107045:c61913-61761 [Klebsiella pneumoniae]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT260493 NZ_CP107045:61963-62025 [Klebsiella pneumoniae]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|