Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3130116..3130702 Replicon chromosome
Accession NZ_CP107043
Organism Klebsiella pneumoniae strain KPTA-2108

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OEC00_RS15100 Protein ID WP_002920800.1
Coordinates 3130334..3130702 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OEC00_RS15095 Protein ID WP_004174006.1
Coordinates 3130116..3130337 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEC00_RS15075 (3126273) 3126273..3127199 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OEC00_RS15080 (3127196) 3127196..3128473 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OEC00_RS15085 (3128470) 3128470..3129237 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OEC00_RS15090 (3129239) 3129239..3129952 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OEC00_RS15095 (3130116) 3130116..3130337 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OEC00_RS15100 (3130334) 3130334..3130702 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OEC00_RS15105 (3130975) 3130975..3132291 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OEC00_RS15110 (3132398) 3132398..3133285 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OEC00_RS15115 (3133282) 3133282..3134127 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OEC00_RS15120 (3134129) 3134129..3135199 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3127196..3135936 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T260484 WP_002920800.1 NZ_CP107043:3130334-3130702 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT260484 WP_004174006.1 NZ_CP107043:3130116-3130337 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References