Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 506712..507037 | Replicon | chromosome |
| Accession | NZ_CP107039 | ||
| Organism | Bacillus subtilis strain 11060 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | ODQ18_RS02755 | Protein ID | WP_128751232.1 |
| Coordinates | 506858..507037 (-) | Length | 60 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 506712..506934 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ODQ18_RS02710 (502081) | 502081..502392 | + | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| ODQ18_RS02715 (502396) | 502396..502791 | + | 396 | WP_004398566.1 | DUF3199 family protein | - |
| ODQ18_RS02720 (502788) | 502788..503150 | + | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| ODQ18_RS02725 (503147) | 503147..503650 | + | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| ODQ18_RS02730 (503663) | 503663..504100 | + | 438 | WP_003229927.1 | hypothetical protein | - |
| ODQ18_RS02735 (504097) | 504097..504288 | + | 192 | WP_010886574.1 | hypothetical protein | - |
| ODQ18_RS02740 (504289) | 504289..505689 | + | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| ODQ18_RS02745 (505692) | 505692..506135 | + | 444 | WP_003229930.1 | phage tail tube protein | - |
| ODQ18_RS02750 (506389) | 506389..506478 | - | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| - (506712) | 506712..506934 | + | 223 | NuclAT_0 | - | Antitoxin |
| - (506712) | 506712..506934 | + | 223 | NuclAT_0 | - | Antitoxin |
| - (506712) | 506712..506934 | + | 223 | NuclAT_0 | - | Antitoxin |
| - (506712) | 506712..506934 | + | 223 | NuclAT_0 | - | Antitoxin |
| ODQ18_RS02755 (506858) | 506858..507037 | - | 180 | WP_128751232.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
| ODQ18_RS02760 (507183) | 507183..507632 | + | 450 | WP_032722171.1 | phage portal protein | - |
| ODQ18_RS02765 (507674) | 507674..507811 | + | 138 | WP_021480099.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 486034..547737 | 61703 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6755.19 Da Isoelectric Point: 8.0288
>T260462 WP_128751232.1 NZ_CP107039:c507037-506858 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT260462 NZ_CP107039:506712-506934 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|