Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1544622..1545217 | Replicon | chromosome |
Accession | NZ_CP107029 | ||
Organism | Pseudomonas aeruginosa strain PALA19 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PALA19_RS07220 | Protein ID | WP_003113526.1 |
Coordinates | 1544622..1544900 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA19_RS07225 | Protein ID | WP_003113527.1 |
Coordinates | 1544912..1545217 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA19_RS07200 (PALA19_01428) | 1540048..1541286 | + | 1239 | WP_003113524.1 | dipeptidase | - |
PALA19_RS07205 (PALA19_01429) | 1541348..1541995 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA19_RS07210 (PALA19_01430) | 1542065..1544293 | - | 2229 | WP_023086667.1 | TonB-dependent receptor | - |
PALA19_RS07215 | 1544441..1544569 | + | 129 | Protein_1422 | integrase | - |
PALA19_RS07220 | 1544622..1544900 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA19_RS07225 (PALA19_01431) | 1544912..1545217 | + | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
PALA19_RS07235 (PALA19_01433) | 1545624..1546724 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA19_RS07240 (PALA19_01434) | 1546765..1547349 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA19_RS07245 (PALA19_01435) | 1547391..1548005 | - | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA19_RS07250 | 1548122..1549063 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA19_RS07260 (PALA19_01437) | 1549230..1550078 | - | 849 | WP_003123430.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T260453 WP_003113526.1 NZ_CP107029:1544622-1544900 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|