Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 95030..95283 | Replicon | plasmid pKPC-K30821 |
| Accession | NZ_CP107017 | ||
| Organism | Klebsiella pneumoniae strain K30821 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OF890_RS29395 | Protein ID | WP_001312851.1 |
| Coordinates | 95134..95283 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 95030..95089 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF890_RS29355 (90412) | 90412..90756 | - | 345 | Protein_119 | IS6-like element IS26 family transposase | - |
| OF890_RS29360 (90808) | 90808..91512 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OF890_RS29365 (91537) | 91537..91737 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| OF890_RS29370 (91757) | 91757..92503 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OF890_RS29375 (92558) | 92558..93118 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OF890_RS29380 (93250) | 93250..93450 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| OF890_RS29385 (93836) | 93836..94435 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OF890_RS29390 (94497) | 94497..94829 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (95030) | 95030..95089 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (95030) | 95030..95089 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (95030) | 95030..95089 | - | 60 | NuclAT_0 | - | Antitoxin |
| - (95030) | 95030..95089 | - | 60 | NuclAT_0 | - | Antitoxin |
| OF890_RS29395 (95134) | 95134..95283 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| OF890_RS29400 (95567) | 95567..95815 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OF890_RS29405 (95930) | 95930..96114 | + | 185 | Protein_129 | protein CopA/IncA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..96126 | 96126 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260444 WP_001312851.1 NZ_CP107017:95134-95283 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260444 NZ_CP107017:c95089-95030 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
