Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 95030..95283 Replicon plasmid pKPC-K30821
Accession NZ_CP107017
Organism Klebsiella pneumoniae strain K30821

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag OF890_RS29395 Protein ID WP_001312851.1
Coordinates 95134..95283 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 95030..95089 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF890_RS29355 (90412) 90412..90756 - 345 Protein_119 IS6-like element IS26 family transposase -
OF890_RS29360 (90808) 90808..91512 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
OF890_RS29365 (91537) 91537..91737 + 201 WP_072354025.1 hypothetical protein -
OF890_RS29370 (91757) 91757..92503 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
OF890_RS29375 (92558) 92558..93118 + 561 WP_000139328.1 fertility inhibition protein FinO -
OF890_RS29380 (93250) 93250..93450 + 201 WP_015059022.1 hypothetical protein -
OF890_RS29385 (93836) 93836..94435 + 600 WP_032083981.1 PIN domain-containing protein -
OF890_RS29390 (94497) 94497..94829 + 333 WP_152916585.1 hypothetical protein -
- (95030) 95030..95089 - 60 NuclAT_0 - Antitoxin
- (95030) 95030..95089 - 60 NuclAT_0 - Antitoxin
- (95030) 95030..95089 - 60 NuclAT_0 - Antitoxin
- (95030) 95030..95089 - 60 NuclAT_0 - Antitoxin
OF890_RS29395 (95134) 95134..95283 + 150 WP_001312851.1 Hok/Gef family protein Toxin
OF890_RS29400 (95567) 95567..95815 + 249 WP_000083837.1 replication regulatory protein RepA -
OF890_RS29405 (95930) 95930..96114 + 185 Protein_129 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 - 1..96126 96126


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T260444 WP_001312851.1 NZ_CP107017:95134-95283 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT260444 NZ_CP107017:c95089-95030 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References