Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 103094..103520 | Replicon | plasmid pSul1-K28074 |
| Accession | NZ_CP107016 | ||
| Organism | Klebsiella pneumoniae strain K30821 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | OF890_RS28610 | Protein ID | WP_001372321.1 |
| Coordinates | 103094..103219 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 103296..103520 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF890_RS28580 (98492) | 98492..99181 | - | 690 | WP_000283387.1 | conjugal transfer transcriptional regulator TraJ | - |
| OF890_RS28585 (99368) | 99368..99751 | - | 384 | WP_001151538.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| OF890_RS28590 (100072) | 100072..100674 | + | 603 | Protein_118 | transglycosylase SLT domain-containing protein | - |
| OF890_RS28595 (100971) | 100971..101791 | - | 821 | Protein_119 | DUF945 domain-containing protein | - |
| OF890_RS28600 (101901) | 101901..102197 | - | 297 | WP_001545326.1 | hypothetical protein | - |
| OF890_RS28605 (102497) | 102497..102793 | + | 297 | Protein_121 | hypothetical protein | - |
| OF890_RS28610 (103094) | 103094..103219 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| OF890_RS28615 (103161) | 103161..103310 | - | 150 | Protein_123 | plasmid maintenance protein Mok | - |
| - (103296) | 103296..103520 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (103296) | 103296..103520 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (103296) | 103296..103520 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (103296) | 103296..103520 | - | 225 | NuclAT_0 | - | Antitoxin |
| OF890_RS28620 (103532) | 103532..104251 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| OF890_RS28625 (104248) | 104248..104682 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| OF890_RS28630 (104751) | 104751..106715 | - | 1965 | WP_001537566.1 | ParB/RepB/Spo0J family partition protein | - |
| OF890_RS28635 (106776) | 106776..107009 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| OF890_RS28640 (107067) | 107067..107552 | - | 486 | WP_031311812.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / aadA2 / dfrA12 | senB | 1..124616 | 124616 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T260440 WP_001372321.1 NZ_CP107016:c103219-103094 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT260440 NZ_CP107016:c103520-103296 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|