Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 60672..60925 | Replicon | plasmid pSul1-K28074 |
| Accession | NZ_CP107016 | ||
| Organism | Klebsiella pneumoniae strain K30821 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | OF890_RS28360 | Protein ID | WP_001336447.1 |
| Coordinates | 60672..60821 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 60869..60925 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF890_RS28325 (56147) | 56147..56917 | + | 771 | WP_000712166.1 | molybdopterin-dependent oxidoreductase | - |
| OF890_RS28330 (56947) | 56947..57195 | + | 249 | WP_000738203.1 | hypothetical protein | - |
| OF890_RS28335 (57345) | 57345..57443 | - | 99 | WP_137491101.1 | transposase | - |
| OF890_RS28340 (57636) | 57636..57944 | + | 309 | Protein_68 | transposase | - |
| OF890_RS28345 (58972) | 58972..59829 | - | 858 | WP_001537577.1 | incFII family plasmid replication initiator RepA | - |
| OF890_RS28350 (59822) | 59822..59896 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| OF890_RS28355 (60130) | 60130..60387 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
| OF890_RS28360 (60672) | 60672..60821 | - | 150 | WP_001336447.1 | Hok/Gef family protein | Toxin |
| - (60869) | 60869..60925 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (60869) | 60869..60925 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (60869) | 60869..60925 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (60869) | 60869..60925 | + | 57 | NuclAT_1 | - | Antitoxin |
| OF890_RS28365 (61020) | 61020..61457 | - | 438 | WP_000872609.1 | hypothetical protein | - |
| OF890_RS28370 (61610) | 61610..61993 | - | 384 | WP_001109264.1 | hypothetical protein | - |
| OF890_RS28375 (62096) | 62096..62557 | - | 462 | WP_000760080.1 | thermonuclease family protein | - |
| OF890_RS28380 (63310) | 63310..63513 | - | 204 | WP_001336517.1 | hypothetical protein | - |
| OF890_RS28385 (63665) | 63665..64222 | - | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
| OF890_RS28390 (64277) | 64277..65023 | - | 747 | WP_000205709.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / aadA2 / dfrA12 | senB | 1..124616 | 124616 | |
| - | flank | IS/Tn | - | - | 57678..57944 | 266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T260436 WP_001336447.1 NZ_CP107016:c60821-60672 [Klebsiella pneumoniae]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 57 bp
>AT260436 NZ_CP107016:60869-60925 [Klebsiella pneumoniae]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
