Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 123110..123837 | Replicon | plasmid pVi-K30821 |
| Accession | NZ_CP107015 | ||
| Organism | Klebsiella pneumoniae strain K30821 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OF890_RS27435 | Protein ID | WP_011251285.1 |
| Coordinates | 123110..123421 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OF890_RS27440 | Protein ID | WP_011251286.1 |
| Coordinates | 123418..123837 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF890_RS27410 (OF890_27410) | 118629..119123 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| OF890_RS27415 (OF890_27415) | 119301..119567 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| OF890_RS27420 (OF890_27420) | 119600..120250 | + | 651 | WP_068893702.1 | DUF1173 family protein | - |
| OF890_RS27430 (OF890_27430) | 122468..122905 | + | 438 | Protein_142 | DDE-type integrase/transposase/recombinase | - |
| OF890_RS27435 (OF890_27435) | 123110..123421 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OF890_RS27440 (OF890_27440) | 123418..123837 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OF890_RS27445 (OF890_27445) | 123984..124952 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| OF890_RS27450 (OF890_27450) | 125024..125389 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| OF890_RS27455 (OF890_27455) | 125403..126191 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| OF890_RS27460 (OF890_27460) | 126212..126832 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| OF890_RS27465 (OF890_27465) | 127251..127886 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| OF890_RS27470 (OF890_27470) | 128199..128669 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN / iroD / iroC / iroB | 1..237143 | 237143 | |
| - | inside | IScluster/Tn | - | - | 114177..139181 | 25004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T260435 WP_011251285.1 NZ_CP107015:123110-123421 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT260435 WP_011251286.1 NZ_CP107015:123418-123837 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|