Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 52785..53049 Replicon plasmid pSZB23-1
Accession NZ_CP107011
Organism Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag OF884_RS22895 Protein ID WP_001331364.1
Coordinates 52897..53049 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 52785..52842 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF884_RS22880 (48024) 48024..50315 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
OF884_RS22885 (50308) 50308..51378 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
OF884_RS22890 (51397) 51397..52605 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (52785) 52785..52842 - 58 NuclAT_0 - Antitoxin
- (52785) 52785..52842 - 58 NuclAT_0 - Antitoxin
- (52785) 52785..52842 - 58 NuclAT_0 - Antitoxin
- (52785) 52785..52842 - 58 NuclAT_0 - Antitoxin
OF884_RS22895 (52897) 52897..53049 + 153 WP_001331364.1 Hok/Gef family protein Toxin
OF884_RS22900 (53121) 53121..53372 - 252 WP_001291964.1 hypothetical protein -
OF884_RS22905 (53734) 53734..53966 + 233 Protein_63 hypothetical protein -
OF884_RS22910 (54031) 54031..54207 - 177 WP_001054904.1 hypothetical protein -
OF884_RS22915 (54599) 54599..54808 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
OF884_RS22920 (54880) 54880..55530 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
OF884_RS22925 (55604) 55604..57772 - 2169 WP_021265679.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul2 / blaCTX-M-14 - 1..97817 97817


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T260415 WP_001331364.1 NZ_CP107011:52897-53049 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT260415 NZ_CP107011:c52842-52785 [Salmonella enterica subsp. enterica serovar Paratyphi B]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References