Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1887756..1888416 | Replicon | chromosome |
| Accession | NZ_CP107010 | ||
| Organism | Salmonella enterica subsp. enterica serovar Paratyphi B strain SZ21B23 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E706 |
| Locus tag | OF884_RS08920 | Protein ID | WP_000269841.1 |
| Coordinates | 1887756..1888109 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OF884_RS08925 | Protein ID | WP_023210258.1 |
| Coordinates | 1888114..1888416 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF884_RS08895 (1883825) | 1883825..1884580 | + | 756 | WP_001089671.1 | multiubiquitin domain-containing protein | - |
| OF884_RS08900 (1884555) | 1884555..1885739 | + | 1185 | WP_000078712.1 | ThiF family adenylyltransferase | - |
| OF884_RS08905 (1885733) | 1885733..1886197 | + | 465 | WP_023210260.1 | DUF6527 family protein | - |
| OF884_RS08910 (1886574) | 1886574..1887041 | + | 468 | WP_000201258.1 | hypothetical protein | - |
| OF884_RS08915 (1887041) | 1887041..1887259 | + | 219 | WP_161976074.1 | cell morphology transcriptional regulator XreR2 | - |
| OF884_RS08920 (1887756) | 1887756..1888109 | + | 354 | WP_000269841.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OF884_RS08925 (1888114) | 1888114..1888416 | + | 303 | WP_023210258.1 | XRE family transcriptional regulator | Antitoxin |
| OF884_RS08930 (1888922) | 1888922..1889806 | + | 885 | WP_023210257.1 | integrase domain-containing protein | - |
| OF884_RS08935 (1890675) | 1890675..1891937 | - | 1263 | WP_000058784.1 | integrase arm-type DNA-binding domain-containing protein | - |
| OF884_RS08945 (1892275) | 1892275..1893072 | - | 798 | WP_000598920.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1862748..1901075 | 38327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13477.35 Da Isoelectric Point: 9.5699
>T260403 WP_000269841.1 NZ_CP107010:1887756-1888109 [Salmonella enterica subsp. enterica serovar Paratyphi B]
VWTIKTTDTFDRWFASLNDTDRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDRWFASLNDTDRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11012.76 Da Isoelectric Point: 5.7316
>AT260403 WP_023210258.1 NZ_CP107010:1888114-1888416 [Salmonella enterica subsp. enterica serovar Paratyphi B]
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFAL
MGRTLEQLIADEKPEVVAEAQAMATDILLNIHLAELREKVQKTQVEMAQALGIRQPTVAGMEKPGRDLKLSTLKRYVEAT
GGKLRLDVELPDGSHYGFAL
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|