Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3753515..3754209 | Replicon | chromosome |
| Accession | NZ_CP107003 | ||
| Organism | Escherichia coli strain SY22B1 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | OFB13_RS18480 | Protein ID | WP_001263489.1 |
| Coordinates | 3753515..3753913 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | OFB13_RS18485 | Protein ID | WP_000554758.1 |
| Coordinates | 3753916..3754209 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3749103) | 3749103..3749183 | - | 81 | NuclAT_12 | - | - |
| - (3749103) | 3749103..3749183 | - | 81 | NuclAT_12 | - | - |
| - (3749103) | 3749103..3749183 | - | 81 | NuclAT_12 | - | - |
| - (3749103) | 3749103..3749183 | - | 81 | NuclAT_12 | - | - |
| OFB13_RS18455 (3749779) | 3749779..3750237 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| OFB13_RS18460 (3750498) | 3750498..3751955 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| OFB13_RS18465 (3752012) | 3752012..3752533 | - | 522 | Protein_3612 | peptide chain release factor H | - |
| OFB13_RS18470 (3752529) | 3752529..3752735 | - | 207 | Protein_3613 | RtcB family protein | - |
| OFB13_RS18475 (3753053) | 3753053..3753505 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| OFB13_RS18480 (3753515) | 3753515..3753913 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| OFB13_RS18485 (3753916) | 3753916..3754209 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| OFB13_RS18490 (3754261) | 3754261..3755316 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| OFB13_RS18495 (3755387) | 3755387..3756172 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| OFB13_RS18500 (3756144) | 3756144..3757856 | + | 1713 | Protein_3619 | flagellar biosynthesis protein FlhA | - |
| OFB13_RS18505 (3758080) | 3758080..3758577 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T260341 WP_001263489.1 NZ_CP107003:c3753913-3753515 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |