Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 10185..10843 | Replicon | plasmid pNY13623-1 |
Accession | NZ_CP106989 | ||
Organism | Acinetobacter baumannii strain NY13623 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OC371_RS19515 | Protein ID | WP_000312250.1 |
Coordinates | 10484..10843 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OC371_RS19510 | Protein ID | WP_001096429.1 |
Coordinates | 10185..10484 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OC371_RS19470 (OC371_19470) | 5209..6489 | + | 1281 | WP_001093570.1 | hypothetical protein | - |
OC371_RS19475 (OC371_19475) | 6594..6851 | + | 258 | WP_000834290.1 | hypothetical protein | - |
OC371_RS19480 (OC371_19480) | 6856..7428 | + | 573 | WP_000443897.1 | hypothetical protein | - |
OC371_RS19485 (OC371_19485) | 7404..7583 | + | 180 | WP_000387630.1 | hypothetical protein | - |
OC371_RS19490 (OC371_19490) | 7600..8229 | + | 630 | WP_000701003.1 | hypothetical protein | - |
OC371_RS19495 (OC371_19495) | 8269..8487 | + | 219 | WP_001043201.1 | hypothetical protein | - |
OC371_RS19500 (OC371_19500) | 8507..9061 | + | 555 | WP_000790084.1 | hypothetical protein | - |
OC371_RS19505 (OC371_19505) | 9111..9647 | + | 537 | WP_000731978.1 | hypothetical protein | - |
OC371_RS19510 (OC371_19510) | 10185..10484 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
OC371_RS19515 (OC371_19515) | 10484..10843 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OC371_RS19520 (OC371_19520) | 11044..11610 | + | 567 | WP_000710385.1 | hypothetical protein | - |
OC371_RS19525 (OC371_19525) | 11659..11841 | + | 183 | WP_000373385.1 | hypothetical protein | - |
OC371_RS19530 (OC371_19530) | 11908..12606 | + | 699 | WP_000873188.1 | hypothetical protein | - |
OC371_RS19535 (OC371_19535) | 12745..13128 | + | 384 | WP_000654348.1 | hypothetical protein | - |
OC371_RS19540 (OC371_19540) | 13195..13953 | + | 759 | WP_001053127.1 | hypothetical protein | - |
OC371_RS19545 (OC371_19545) | 15008..15322 | + | 315 | WP_000708714.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..67024 | 67024 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T260113 WP_000312250.1 NZ_CP106989:c10843-10484 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|