Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 4035119..4035716 | Replicon | chromosome |
| Accession | NZ_CP106964 | ||
| Organism | Klebsiella variicola strain SY1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0B7GEF2 |
| Locus tag | OCU08_RS19475 | Protein ID | WP_012542526.1 |
| Coordinates | 4035399..4035716 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OCU08_RS19470 | Protein ID | WP_012542525.1 |
| Coordinates | 4035119..4035406 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OCU08_RS19440 | 4031029..4031277 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
| OCU08_RS19445 | 4031294..4031635 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| OCU08_RS19450 | 4031666..4032781 | - | 1116 | WP_162493283.1 | MBL fold metallo-hydrolase | - |
| OCU08_RS19455 | 4032961..4033542 | + | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
| OCU08_RS19460 | 4033542..4033910 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
| OCU08_RS19465 | 4034030..4034683 | + | 654 | WP_012968755.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| OCU08_RS19470 | 4035119..4035406 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OCU08_RS19475 | 4035399..4035716 | - | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OCU08_RS19480 | 4035901..4036944 | - | 1044 | WP_016160437.1 | DUF2157 domain-containing protein | - |
| OCU08_RS19485 | 4037474..4038340 | - | 867 | WP_008805530.1 | helix-turn-helix transcriptional regulator | - |
| OCU08_RS19490 | 4038449..4039876 | + | 1428 | WP_072121872.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T260101 WP_012542526.1 NZ_CP106964:c4035716-4035399 [Klebsiella variicola]
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|