Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4101619..4102313 | Replicon | chromosome |
| Accession | NZ_CP106929 | ||
| Organism | Escherichia coli strain MFDS1001074 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | OEG89_RS20390 | Protein ID | WP_001263489.1 |
| Coordinates | 4101915..4102313 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | OEG89_RS20385 | Protein ID | WP_000554758.1 |
| Coordinates | 4101619..4101912 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG89_RS20365 (4097251) | 4097251..4097748 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| OEG89_RS20370 (4097972) | 4097972..4099684 | - | 1713 | Protein_3964 | flagellar biosynthesis protein FlhA | - |
| OEG89_RS20375 (4099656) | 4099656..4100441 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| OEG89_RS20380 (4100512) | 4100512..4101567 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| OEG89_RS20385 (4101619) | 4101619..4101912 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| OEG89_RS20390 (4101915) | 4101915..4102313 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| OEG89_RS20395 (4102323) | 4102323..4102775 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| OEG89_RS20400 (4103093) | 4103093..4103299 | + | 207 | Protein_3970 | RtcB family protein | - |
| OEG89_RS20405 (4103295) | 4103295..4103816 | + | 522 | Protein_3971 | peptide chain release factor H | - |
| OEG89_RS20410 (4103873) | 4103873..4105330 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| OEG89_RS20415 (4105591) | 4105591..4106049 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (4106645) | 4106645..4106725 | + | 81 | NuclAT_12 | - | - |
| - (4106645) | 4106645..4106725 | + | 81 | NuclAT_12 | - | - |
| - (4106645) | 4106645..4106725 | + | 81 | NuclAT_12 | - | - |
| - (4106645) | 4106645..4106725 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | hcp1/tssD1 / tssA / rhs/PAAR / gmhA/lpcA | 4072188..4131621 | 59433 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T260085 WP_001263489.1 NZ_CP106929:4101915-4102313 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |