Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4101619..4102313 Replicon chromosome
Accession NZ_CP106929
Organism Escherichia coli strain MFDS1001074

Toxin (Protein)


Gene name yafO Uniprot ID Q47157
Locus tag OEG89_RS20390 Protein ID WP_001263489.1
Coordinates 4101915..4102313 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag OEG89_RS20385 Protein ID WP_000554758.1
Coordinates 4101619..4101912 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OEG89_RS20365 (4097251) 4097251..4097748 + 498 WP_000006255.1 REP-associated tyrosine transposase RayT -
OEG89_RS20370 (4097972) 4097972..4099684 - 1713 Protein_3964 flagellar biosynthesis protein FlhA -
OEG89_RS20375 (4099656) 4099656..4100441 + 786 WP_000207552.1 putative lateral flagellar export/assembly protein LafU -
OEG89_RS20380 (4100512) 4100512..4101567 + 1056 WP_001226164.1 DNA polymerase IV -
OEG89_RS20385 (4101619) 4101619..4101912 + 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
OEG89_RS20390 (4101915) 4101915..4102313 + 399 WP_001263489.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
OEG89_RS20395 (4102323) 4102323..4102775 + 453 WP_001059892.1 GNAT family N-acetyltransferase -
OEG89_RS20400 (4103093) 4103093..4103299 + 207 Protein_3970 RtcB family protein -
OEG89_RS20405 (4103295) 4103295..4103816 + 522 Protein_3971 peptide chain release factor H -
OEG89_RS20410 (4103873) 4103873..4105330 - 1458 WP_001292994.1 cytosol nonspecific dipeptidase -
OEG89_RS20415 (4105591) 4105591..4106049 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (4106645) 4106645..4106725 + 81 NuclAT_12 - -
- (4106645) 4106645..4106725 + 81 NuclAT_12 - -
- (4106645) 4106645..4106725 + 81 NuclAT_12 - -
- (4106645) 4106645..4106725 + 81 NuclAT_12 - -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - hcp1/tssD1 / tssA / rhs/PAAR / gmhA/lpcA 4072188..4131621 59433


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15487.84 Da        Isoelectric Point: 7.4215

>T260085 WP_001263489.1 NZ_CP106929:4101915-4102313 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT260085 WP_000554758.1 NZ_CP106929:4101619-4101912 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A090J8B1

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References