Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2280186..2280985 | Replicon | chromosome |
Accession | NZ_CP106929 | ||
Organism | Escherichia coli strain MFDS1001074 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | OEG89_RS11545 | Protein ID | WP_000347273.1 |
Coordinates | 2280186..2280650 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | OEG89_RS11550 | Protein ID | WP_001307405.1 |
Coordinates | 2280650..2280985 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG89_RS11515 (2275187) | 2275187..2275621 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
OEG89_RS11520 (2275639) | 2275639..2276517 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
OEG89_RS11525 (2276507) | 2276507..2277286 | - | 780 | WP_000406209.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
OEG89_RS11530 (2277297) | 2277297..2277770 | - | 474 | WP_001336162.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
OEG89_RS11535 (2277793) | 2277793..2279073 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
OEG89_RS11540 (2279322) | 2279322..2280131 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
OEG89_RS11545 (2280186) | 2280186..2280650 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
OEG89_RS11550 (2280650) | 2280650..2280985 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
OEG89_RS11555 (2281134) | 2281134..2282705 | - | 1572 | WP_001273753.1 | galactarate dehydratase | - |
OEG89_RS11560 (2283080) | 2283080..2284414 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
OEG89_RS11565 (2284430) | 2284430..2285200 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2255315..2291860 | 36545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T260078 WP_000347273.1 NZ_CP106929:c2280650-2280186 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SSH7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |