Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1072259..1072986 | Replicon | chromosome |
| Accession | NZ_CP106924 | ||
| Organism | Escherichia coli strain MFDS1016424 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | OEG87_RS05205 | Protein ID | WP_000547563.1 |
| Coordinates | 1072259..1072570 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OEG87_RS05210 | Protein ID | WP_000126294.1 |
| Coordinates | 1072567..1072986 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG87_RS05175 (1067402) | 1067402..1069111 | + | 1710 | WP_063625439.1 | formate hydrogenlyase subunit HycE | - |
| OEG87_RS05180 (1069121) | 1069121..1069663 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| OEG87_RS05185 (1069663) | 1069663..1070430 | + | 768 | WP_000067401.1 | formate hydrogenlyase subunit HycG | - |
| OEG87_RS05190 (1070427) | 1070427..1070837 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| OEG87_RS05195 (1070830) | 1070830..1071300 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| OEG87_RS05200 (1071343) | 1071343..1072086 | + | 744 | WP_058101263.1 | hypothetical protein | - |
| OEG87_RS05205 (1072259) | 1072259..1072570 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OEG87_RS05210 (1072567) | 1072567..1072986 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OEG87_RS05215 (1073231) | 1073231..1074211 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
| OEG87_RS05220 (1074379) | 1074379..1075803 | - | 1425 | WP_000110365.1 | 6-phospho-beta-glucosidase AscB | - |
| OEG87_RS05225 (1075812) | 1075812..1077269 | - | 1458 | WP_001107882.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1073231..1074211 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T260047 WP_000547563.1 NZ_CP106924:1072259-1072570 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT260047 WP_000126294.1 NZ_CP106924:1072567-1072986 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|