Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 609763..610562 | Replicon | chromosome |
Accession | NZ_CP106924 | ||
Organism | Escherichia coli strain MFDS1016424 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | OEG87_RS02990 | Protein ID | WP_000347251.1 |
Coordinates | 609763..610227 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | D6JF08 |
Locus tag | OEG87_RS02995 | Protein ID | WP_001308975.1 |
Coordinates | 610227..610562 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG87_RS02960 (604764) | 604764..605198 | - | 435 | WP_087901835.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
OEG87_RS02965 (605216) | 605216..606094 | - | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
OEG87_RS02970 (606084) | 606084..606863 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
OEG87_RS02975 (606874) | 606874..607347 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
OEG87_RS02980 (607370) | 607370..608650 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
OEG87_RS02985 (608899) | 608899..609708 | + | 810 | WP_000072180.1 | aga operon transcriptional regulator AgaR | - |
OEG87_RS02990 (609763) | 609763..610227 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
OEG87_RS02995 (610227) | 610227..610562 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
OEG87_RS03000 (610711) | 610711..612282 | - | 1572 | WP_075826719.1 | galactarate dehydratase | - |
OEG87_RS03005 (612657) | 612657..613991 | + | 1335 | WP_075826720.1 | galactarate/glucarate/glycerate transporter GarP | - |
OEG87_RS03010 (614007) | 614007..614777 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T260044 WP_000347251.1 NZ_CP106924:c610227-609763 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D6JF08 |