Detailed information of TA system TA260034

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 97248..97517
• Replicon: plasmid unnamed3
• Accession: NZ_CP106915
• Organism: Klebsiella pneumoniae strain BSIKPN-9

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: OE131_RS29955
• Protein ID: WP_001372321.1
• Coordinates: 97392..97517 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	97248..97313 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OE131_RS29925	92958..93485	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
OE131_RS29930	93543..93776	+	234	WP_000006003.1	DUF905 family protein	-
OE131_RS29935	93837..95860	+	2024	Protein_132	ParB/RepB/Spo0J family partition protein	-
OE131_RS29940	95929..96363	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
OE131_RS29945	96360..97079	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	97091..97315	+	225	NuclAT_0	-	-
-	97091..97315	+	225	NuclAT_0	-	-
-	97091..97315	+	225	NuclAT_0	-	-
-	97091..97315	+	225	NuclAT_0	-	-
-	97248..97313	-	66	-	-	Antitoxin
OE131_RS29950	97301..97450	+	150	Protein_135	plasmid maintenance protein Mok	-
OE131_RS29955	97392..97517	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
OE131_RS29960	97836..98132	-	297	Protein_137	hypothetical protein	-
OE131_RS29965	98432..98728	+	297	WP_001272251.1	hypothetical protein	-
OE131_RS29970	98839..99660	+	822	WP_001234445.1	DUF932 domain-containing protein	-
OE131_RS29975	99957..100604	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
OE131_RS29980	100881..101264	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
OE131_RS29985	101455..102141	+	687	WP_015059009.1	PAS domain-containing protein	-
OE131_RS29990	102235..102462	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	blaKPC-2 / fosA3 / blaTEM-1B / rmtB	-	1..120349	120349

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T260034 WP_001372321.1 NZ_CP106915:97392-97517 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT260034 NZ_CP106915:c97313-97248 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin