Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 134617..135274 Replicon plasmid unnamed2
Accession NZ_CP106914
Organism Klebsiella pneumoniae strain BSIKPN-9

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag OE131_RS29075 Protein ID WP_000270043.1
Coordinates 134617..134967 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OE131_RS29080 Protein ID WP_000124640.1
Coordinates 134972..135274 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE131_RS29040 (OE131_29040) 131091..131588 - 498 WP_000062185.1 hypothetical protein -
OE131_RS29045 (OE131_29045) 131591..132079 - 489 WP_001273096.1 DUF1643 domain-containing protein -
OE131_RS29050 (OE131_29050) 132176..132511 + 336 WP_000683476.1 hypothetical protein -
OE131_RS29055 (OE131_29055) 132526..132996 - 471 WP_001281821.1 hypothetical protein -
OE131_RS29060 (OE131_29060) 132989..133360 - 372 WP_000516916.1 hypothetical protein -
OE131_RS29065 (OE131_29065) 133371..133565 - 195 WP_000343597.1 hypothetical protein -
OE131_RS29070 (OE131_29070) 133906..134454 - 549 WP_001061574.1 transcriptional regulator -
OE131_RS29075 (OE131_29075) 134617..134967 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OE131_RS29080 (OE131_29080) 134972..135274 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
OE131_RS29085 (OE131_29085) 135301..135594 - 294 WP_001239997.1 chromosome segregation protein ParM -
OE131_RS29090 (OE131_29090) 135682..135954 - 273 WP_001043047.1 HU family DNA-binding protein -
OE131_RS29095 (OE131_29095) 136012..136539 - 528 WP_001236377.1 thermonuclease family protein -
OE131_RS29100 (OE131_29100) 136770..137627 - 858 WP_001167032.1 hypothetical protein -
OE131_RS29105 (OE131_29105) 137614..137844 - 231 WP_000972663.1 hypothetical protein -
OE131_RS29110 (OE131_29110) 137844..138362 - 519 WP_000210756.1 nitrite reductase -
OE131_RS29115 (OE131_29115) 138359..138805 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
OE131_RS29120 (OE131_29120) 138805..139164 - 360 WP_000422768.1 hypothetical protein -
OE131_RS29125 (OE131_29125) 139221..139649 - 429 WP_000591074.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / ARR-3 / cmlA1 / blaOXA-10 / ant(3'')-Ia / qacE / sul1 / sul2 / floR / tet(D) - 1..167656 167656


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T260028 WP_000270043.1 NZ_CP106914:134617-134967 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT260028 WP_000124640.1 NZ_CP106914:134972-135274 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References