Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 59985..60712 Replicon plasmid unnamed1
Accession NZ_CP106913
Organism Klebsiella pneumoniae strain BSIKPN-9

Toxin (Protein)


Gene name higB Uniprot ID A0A7W3D9W1
Locus tag OE131_RS27395 Protein ID WP_011251285.1
Coordinates 60401..60712 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OE131_RS27390 Protein ID WP_011251286.1
Coordinates 59985..60404 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE131_RS27360 (OE131_27360) 55153..55623 - 471 WP_048333570.1 hypothetical protein -
OE131_RS27365 (OE131_27365) 55936..56571 - 636 WP_223171879.1 hypothetical protein -
OE131_RS27370 (OE131_27370) 56990..57610 + 621 WP_223175004.1 conjugative transfer protein MobI(A/C) -
OE131_RS27375 (OE131_27375) 57631..58419 + 789 WP_040217257.1 hypothetical protein -
OE131_RS27380 (OE131_27380) 58433..58798 + 366 WP_048333448.1 hypothetical protein -
OE131_RS27385 (OE131_27385) 58870..59838 - 969 WP_074428168.1 IS5 family transposase -
OE131_RS27390 (OE131_27390) 59985..60404 - 420 WP_011251286.1 helix-turn-helix domain-containing protein Antitoxin
OE131_RS27395 (OE131_27395) 60401..60712 - 312 WP_011251285.1 type II toxin-antitoxin system HigB family toxin Toxin
OE131_RS27400 (OE131_27400) 60917..61354 - 438 Protein_60 DDE-type integrase/transposase/recombinase -
OE131_RS27405 (OE131_27405) 61489..62186 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
OE131_RS27410 (OE131_27410) 62188..62637 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
OE131_RS27415 (OE131_27415) 62654..62965 + 312 WP_011251282.1 hypothetical protein -
OE131_RS27420 (OE131_27420) 62979..63320 + 342 WP_011251281.1 hypothetical protein -
OE131_RS27425 (OE131_27425) 63380..64336 + 957 WP_011251280.1 DsbA family protein -
OE131_RS27430 (OE131_27430) 64761..65201 - 441 WP_011251275.1 hypothetical protein -
OE131_RS27435 (OE131_27435) 65207..65701 - 495 WP_011251274.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..216672 216672
- inside IScluster/Tn - - 43314..67621 24307


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12346.12 Da        Isoelectric Point: 9.7248

>T260025 WP_011251285.1 NZ_CP106913:c60712-60401 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15377.46 Da        Isoelectric Point: 4.4420

>AT260025 WP_011251286.1 NZ_CP106913:c60404-59985 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W3D9W1

Antitoxin

Source ID Structure

References