Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 59985..60712 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP106913 | ||
| Organism | Klebsiella pneumoniae strain BSIKPN-9 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OE131_RS27395 | Protein ID | WP_011251285.1 |
| Coordinates | 60401..60712 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OE131_RS27390 | Protein ID | WP_011251286.1 |
| Coordinates | 59985..60404 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OE131_RS27360 (OE131_27360) | 55153..55623 | - | 471 | WP_048333570.1 | hypothetical protein | - |
| OE131_RS27365 (OE131_27365) | 55936..56571 | - | 636 | WP_223171879.1 | hypothetical protein | - |
| OE131_RS27370 (OE131_27370) | 56990..57610 | + | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| OE131_RS27375 (OE131_27375) | 57631..58419 | + | 789 | WP_040217257.1 | hypothetical protein | - |
| OE131_RS27380 (OE131_27380) | 58433..58798 | + | 366 | WP_048333448.1 | hypothetical protein | - |
| OE131_RS27385 (OE131_27385) | 58870..59838 | - | 969 | WP_074428168.1 | IS5 family transposase | - |
| OE131_RS27390 (OE131_27390) | 59985..60404 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OE131_RS27395 (OE131_27395) | 60401..60712 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OE131_RS27400 (OE131_27400) | 60917..61354 | - | 438 | Protein_60 | DDE-type integrase/transposase/recombinase | - |
| OE131_RS27405 (OE131_27405) | 61489..62186 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| OE131_RS27410 (OE131_27410) | 62188..62637 | + | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| OE131_RS27415 (OE131_27415) | 62654..62965 | + | 312 | WP_011251282.1 | hypothetical protein | - |
| OE131_RS27420 (OE131_27420) | 62979..63320 | + | 342 | WP_011251281.1 | hypothetical protein | - |
| OE131_RS27425 (OE131_27425) | 63380..64336 | + | 957 | WP_011251280.1 | DsbA family protein | - |
| OE131_RS27430 (OE131_27430) | 64761..65201 | - | 441 | WP_011251275.1 | hypothetical protein | - |
| OE131_RS27435 (OE131_27435) | 65207..65701 | - | 495 | WP_011251274.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..216672 | 216672 | |
| - | inside | IScluster/Tn | - | - | 43314..67621 | 24307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T260025 WP_011251285.1 NZ_CP106913:c60712-60401 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT260025 WP_011251286.1 NZ_CP106913:c60404-59985 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|