Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 6993..7650 Replicon plasmid unnamed3
Accession NZ_CP106909
Organism Klebsiella pneumoniae strain BSIKPN-11

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag OE130_RS29650 Protein ID WP_000270043.1
Coordinates 6993..7343 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OE130_RS29655 Protein ID WP_000124640.1
Coordinates 7348..7650 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OE130_RS29615 (OE130_29615) 3467..3964 - 498 WP_000062185.1 hypothetical protein -
OE130_RS29620 (OE130_29620) 3967..4455 - 489 WP_001273096.1 DUF1643 domain-containing protein -
OE130_RS29625 (OE130_29625) 4552..4887 + 336 WP_000683476.1 hypothetical protein -
OE130_RS29630 (OE130_29630) 4902..5372 - 471 WP_001281821.1 hypothetical protein -
OE130_RS29635 (OE130_29635) 5365..5736 - 372 WP_000516916.1 hypothetical protein -
OE130_RS29640 (OE130_29640) 5747..5941 - 195 WP_000343597.1 hypothetical protein -
OE130_RS29645 (OE130_29645) 6282..6830 - 549 WP_001061574.1 transcriptional regulator -
OE130_RS29650 (OE130_29650) 6993..7343 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OE130_RS29655 (OE130_29655) 7348..7650 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
OE130_RS29660 (OE130_29660) 7677..7970 - 294 WP_001239997.1 chromosome segregation protein ParM -
OE130_RS29665 (OE130_29665) 8058..8330 - 273 WP_001043047.1 HU family DNA-binding protein -
OE130_RS29670 (OE130_29670) 8388..8915 - 528 WP_001236377.1 thermonuclease family protein -
OE130_RS29675 (OE130_29675) 9146..10003 - 858 WP_001167032.1 hypothetical protein -
OE130_RS29680 (OE130_29680) 9990..10220 - 231 WP_000972663.1 hypothetical protein -
OE130_RS29685 (OE130_29685) 10220..10738 - 519 WP_000210756.1 nitrite reductase -
OE130_RS29690 (OE130_29690) 10735..11181 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
OE130_RS29695 (OE130_29695) 11181..11540 - 360 WP_000422768.1 hypothetical protein -
OE130_RS29700 (OE130_29700) 11597..12025 - 429 WP_000591074.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / ARR-3 / cmlA1 / blaOXA-10 / ant(3'')-Ia / qacE / sul1 / sul2 / floR / tet(D) - 1..166350 166350


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T260009 WP_000270043.1 NZ_CP106909:6993-7343 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT260009 WP_000124640.1 NZ_CP106909:7348-7650 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References