Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 102329..103056 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP106908 | ||
| Organism | Klebsiella pneumoniae strain BSIKPN-11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | OE130_RS29010 | Protein ID | WP_011251285.1 |
| Coordinates | 102329..102640 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OE130_RS29015 | Protein ID | WP_011251286.1 |
| Coordinates | 102637..103056 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OE130_RS28970 (OE130_28970) | 97340..97834 | + | 495 | WP_011251274.1 | hypothetical protein | - |
| OE130_RS28975 (OE130_28975) | 97840..98280 | + | 441 | WP_011251275.1 | hypothetical protein | - |
| OE130_RS28980 (OE130_28980) | 98705..99661 | - | 957 | WP_011251280.1 | DsbA family protein | - |
| OE130_RS28985 (OE130_28985) | 99721..100062 | - | 342 | WP_011251281.1 | hypothetical protein | - |
| OE130_RS28990 (OE130_28990) | 100076..100387 | - | 312 | WP_011251282.1 | hypothetical protein | - |
| OE130_RS28995 (OE130_28995) | 100404..100853 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| OE130_RS29005 (OE130_29005) | 101687..102124 | + | 438 | Protein_117 | DDE-type integrase/transposase/recombinase | - |
| OE130_RS29010 (OE130_29010) | 102329..102640 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OE130_RS29015 (OE130_29015) | 102637..103056 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| OE130_RS29020 (OE130_29020) | 103203..104171 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| OE130_RS29025 (OE130_29025) | 104243..104608 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| OE130_RS29030 (OE130_29030) | 104622..105410 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| OE130_RS29035 (OE130_29035) | 105431..106051 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| OE130_RS29040 (OE130_29040) | 106470..107105 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| OE130_RS29045 (OE130_29045) | 107418..107888 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..216672 | 216672 | |
| - | inside | IScluster/Tn | - | - | 95420..119727 | 24307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T260008 WP_011251285.1 NZ_CP106908:102329-102640 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT260008 WP_011251286.1 NZ_CP106908:102637-103056 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|