Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 79276..79529 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP106907 | ||
| Organism | Klebsiella pneumoniae strain BSIKPN-11 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | OE130_RS27620 | Protein ID | WP_001312851.1 |
| Coordinates | 79276..79425 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 79470..79529 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OE130_RS27585 (74635) | 74635..75050 | - | 416 | Protein_97 | IS1 family transposase | - |
| OE130_RS27590 (75299) | 75299..75700 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| OE130_RS27595 (75633) | 75633..75890 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| OE130_RS27600 (75983) | 75983..76636 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| OE130_RS27605 (77575) | 77575..78432 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| OE130_RS27610 (78451) | 78451..78629 | - | 179 | Protein_102 | protein CopA/IncA | - |
| OE130_RS27615 (78744) | 78744..78992 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| OE130_RS27620 (79276) | 79276..79425 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (79470) | 79470..79529 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79470) | 79470..79529 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79470) | 79470..79529 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (79470) | 79470..79529 | + | 60 | NuclAT_1 | - | Antitoxin |
| OE130_RS27625 (79730) | 79730..80062 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| OE130_RS27630 (80124) | 80124..80723 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| OE130_RS27635 (81109) | 81109..81309 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| OE130_RS27640 (81441) | 81441..82001 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| OE130_RS27645 (82056) | 82056..82802 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| OE130_RS27650 (82822) | 82822..83022 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| OE130_RS27655 (83047) | 83047..83751 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| OE130_RS27660 (83803) | 83803..84147 | + | 345 | Protein_112 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | rmtB / blaTEM-1B / fosA3 / blaKPC-2 | - | 1..216864 | 216864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T260001 WP_001312851.1 NZ_CP106907:c79425-79276 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT260001 NZ_CP106907:79470-79529 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|