Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 44928..45354 | Replicon | plasmid unnamed1 |
Accession | NZ_CP106907 | ||
Organism | Klebsiella pneumoniae strain BSIKPN-11 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | OE130_RS27380 | Protein ID | WP_001372321.1 |
Coordinates | 44928..45053 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 45130..45354 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OE130_RS27345 (39983) | 39983..40210 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
OE130_RS27350 (40304) | 40304..40990 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
OE130_RS27355 (41181) | 41181..41564 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
OE130_RS27360 (41841) | 41841..42488 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
OE130_RS27365 (42785) | 42785..43606 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
OE130_RS27370 (43717) | 43717..44013 | - | 297 | WP_001272251.1 | hypothetical protein | - |
OE130_RS27375 (44313) | 44313..44609 | + | 297 | Protein_55 | hypothetical protein | - |
OE130_RS27380 (44928) | 44928..45053 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
OE130_RS27385 (44995) | 44995..45144 | - | 150 | Protein_57 | plasmid maintenance protein Mok | - |
- (45130) | 45130..45354 | - | 225 | NuclAT_0 | - | Antitoxin |
- (45130) | 45130..45354 | - | 225 | NuclAT_0 | - | Antitoxin |
- (45130) | 45130..45354 | - | 225 | NuclAT_0 | - | Antitoxin |
- (45130) | 45130..45354 | - | 225 | NuclAT_0 | - | Antitoxin |
OE130_RS27390 (45366) | 45366..46085 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
OE130_RS27395 (46082) | 46082..46516 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
OE130_RS27400 (46585) | 46585..48608 | - | 2024 | Protein_60 | ParB/RepB/Spo0J family partition protein | - |
OE130_RS27405 (48669) | 48669..48902 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
OE130_RS27410 (48960) | 48960..49487 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
OE130_RS27415 (49789) | 49789..50244 | + | 456 | Protein_63 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | rmtB / blaTEM-1B / fosA3 / blaKPC-2 | - | 1..216864 | 216864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T259998 WP_001372321.1 NZ_CP106907:c45053-44928 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT259998 NZ_CP106907:c45354-45130 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|