Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 31734..32464 | Replicon | chromosome |
| Accession | NZ_CP106894 | ||
| Organism | Enterobacter hormaechei strain EHX_PAT_001 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A837FIL2 |
| Locus tag | N6139_RS00155 | Protein ID | WP_023302825.1 |
| Coordinates | 31734..32048 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A837FJX0 |
| Locus tag | N6139_RS00160 | Protein ID | WP_015570115.1 |
| Coordinates | 32048..32464 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6139_RS00130 (N6139_00130) | 27400..28485 | + | 1086 | Protein_25 | cellulase family glycosylhydrolase | - |
| N6139_RS00135 (N6139_00135) | 28391..29575 | - | 1185 | WP_048245027.1 | multidrug efflux MFS transporter EmrD | - |
| N6139_RS00140 (N6139_00140) | 29751..30584 | - | 834 | WP_023323922.1 | DMT family transporter | - |
| N6139_RS00145 (N6139_00145) | 30647..31093 | - | 447 | WP_003861064.1 | GNAT family N-acetyltransferase | - |
| N6139_RS00150 (N6139_00150) | 31158..31247 | - | 90 | WP_022646551.1 | type I toxin-antitoxin system toxin TisB | - |
| N6139_RS00155 (N6139_00155) | 31734..32048 | + | 315 | WP_023302825.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N6139_RS00160 (N6139_00160) | 32048..32464 | + | 417 | WP_015570115.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N6139_RS00165 (N6139_00165) | 32611..32709 | + | 99 | WP_057979964.1 | ilvB operon leader peptide IvbL | - |
| N6139_RS00170 (N6139_00170) | 32939..34627 | + | 1689 | WP_003861056.1 | acetolactate synthase large subunit | - |
| N6139_RS00175 (N6139_00175) | 34631..34918 | + | 288 | WP_003861055.1 | acetolactate synthase small subunit | - |
| N6139_RS00180 (N6139_00180) | 35001..35594 | + | 594 | WP_003861054.1 | transcriptional regulator UhpA | - |
| N6139_RS00185 (N6139_00185) | 35591..37096 | + | 1506 | WP_003861052.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12415.51 Da Isoelectric Point: 10.2825
>T259969 WP_023302825.1 NZ_CP106894:31734-32048 [Enterobacter hormaechei]
MHLISMKAILDAVSQFPQHREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
MHLISMKAILDAVSQFPQHREELLFLGRVIEKSHCPTPAALRKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15367.95 Da Isoelectric Point: 5.7670
>AT259969 WP_015570115.1 NZ_CP106894:32048-32464 [Enterobacter hormaechei]
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISRYEANRPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
MIVADAMKATHALVAAVPLLGEQPSEKDYKDALELVEYLLMNEPNSPLLDIVCARISRYEANRPEIVALRKEMESVPVGI
AVLRTLMDQYNLTISDFKDEIGSKSMVSRVLNGQRQLTLNHIKKLAARFGVSPALFIE
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FIL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FJX0 |