Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 772203..772978 | Replicon | chromosome |
Accession | NZ_CP106890 | ||
Organism | Klebsiella pneumoniae strain KPN_SINK_001 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | N6138_RS03900 | Protein ID | WP_004150910.1 |
Coordinates | 772493..772978 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | N6138_RS03895 | Protein ID | WP_004150912.1 |
Coordinates | 772203..772496 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6138_RS03875 (N6138_03875) | 767411..768013 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
N6138_RS03880 (N6138_03880) | 768111..769022 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
N6138_RS03885 (N6138_03885) | 769023..770171 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
N6138_RS03890 (N6138_03890) | 770182..771558 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
N6138_RS03895 (N6138_03895) | 772203..772496 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
N6138_RS03900 (N6138_03900) | 772493..772978 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
N6138_RS03905 (N6138_03905) | 773682..774275 | + | 594 | WP_004188553.1 | hypothetical protein | - |
N6138_RS03910 (N6138_03910) | 774372..774588 | + | 217 | Protein_769 | transposase | - |
N6138_RS03915 (N6138_03915) | 775194..776066 | + | 873 | WP_004188557.1 | ParA family protein | - |
N6138_RS03920 (N6138_03920) | 776066..776449 | + | 384 | WP_004150906.1 | hypothetical protein | - |
N6138_RS03925 (N6138_03925) | 776442..777809 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 774372..774524 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T259954 WP_004150910.1 NZ_CP106890:772493-772978 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |