Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325726..326312 Replicon chromosome
Accession NZ_CP106890
Organism Klebsiella pneumoniae strain KPN_SINK_001

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag N6138_RS01510 Protein ID WP_002920800.1
Coordinates 325944..326312 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag N6138_RS01505 Protein ID WP_002920802.1
Coordinates 325726..325947 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6138_RS01485 (N6138_01485) 321883..322809 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N6138_RS01490 (N6138_01490) 322806..324083 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
N6138_RS01495 (N6138_01495) 324080..324847 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N6138_RS01500 (N6138_01500) 324849..325562 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N6138_RS01505 (N6138_01505) 325726..325947 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N6138_RS01510 (N6138_01510) 325944..326312 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N6138_RS01515 (N6138_01515) 326585..327901 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N6138_RS01520 (N6138_01520) 328008..328895 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N6138_RS01525 (N6138_01525) 328892..329737 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N6138_RS01530 (N6138_01530) 329739..330809 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 322806..331546 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T259952 WP_002920800.1 NZ_CP106890:325944-326312 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT259952 WP_002920802.1 NZ_CP106890:325726-325947 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References