Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325715..326301 Replicon chromosome
Accession NZ_CP106886
Organism Klebsiella pneumoniae strain KPN_PAT_001

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag N6137_RS01510 Protein ID WP_002920800.1
Coordinates 325933..326301 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag N6137_RS01505 Protein ID WP_002920802.1
Coordinates 325715..325936 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6137_RS01485 (N6137_01485) 321872..322798 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N6137_RS01490 (N6137_01490) 322795..324072 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
N6137_RS01495 (N6137_01495) 324069..324836 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N6137_RS01500 (N6137_01500) 324838..325551 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N6137_RS01505 (N6137_01505) 325715..325936 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N6137_RS01510 (N6137_01510) 325933..326301 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N6137_RS01515 (N6137_01515) 326574..327890 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N6137_RS01520 (N6137_01520) 327997..328884 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N6137_RS01525 (N6137_01525) 328881..329726 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N6137_RS01530 (N6137_01530) 329728..330798 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 322795..331535 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T259935 WP_002920800.1 NZ_CP106886:325933-326301 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT259935 WP_002920802.1 NZ_CP106886:325715-325936 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References