Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 107872..108556 | Replicon | plasmid unnamed2 |
Accession | NZ_CP106883 | ||
Organism | Acidovorax sp. 5MLIR |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | M9799_RS20455 | Protein ID | WP_231045138.1 |
Coordinates | 108191..108556 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M9799_RS20450 | Protein ID | WP_231045137.1 |
Coordinates | 107872..108198 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9799_RS20430 (M9799_20430) | 103557..104045 | + | 489 | WP_231045134.1 | conjugal transfer protein TrbH | - |
M9799_RS20435 (M9799_20435) | 104032..105375 | + | 1344 | WP_231045135.1 | TrbI/VirB10 family protein | - |
M9799_RS20440 (M9799_20440) | 105429..106415 | - | 987 | Protein_107 | DUF4238 domain-containing protein | - |
M9799_RS20445 (M9799_20445) | 106585..106893 | - | 309 | WP_231045136.1 | H-NS histone family protein | - |
M9799_RS20450 (M9799_20450) | 107872..108198 | - | 327 | WP_231045137.1 | XRE family transcriptional regulator | Antitoxin |
M9799_RS20455 (M9799_20455) | 108191..108556 | - | 366 | WP_231045138.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M9799_RS20460 (M9799_20460) | 108704..109147 | + | 444 | WP_231045149.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
M9799_RS20465 (M9799_20465) | 109150..109278 | + | 129 | Protein_112 | DNA polymerase V subunit UmuC | - |
M9799_RS20470 (M9799_20470) | 109464..110663 | - | 1200 | WP_231045139.1 | MFS transporter | - |
M9799_RS20475 (M9799_20475) | 110676..111361 | - | 686 | Protein_114 | arsenical resistance protein ArsH | - |
M9799_RS20480 (M9799_20480) | 111378..111809 | - | 432 | WP_231045141.1 | arsenate reductase (glutaredoxin) | - |
M9799_RS20485 (M9799_20485) | 111835..113124 | - | 1290 | WP_231045142.1 | arsenic transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..131045 | 131045 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13931.43 Da Isoelectric Point: 5.5367
>T259928 WP_231045138.1 NZ_CP106883:c108556-108191 [Acidovorax sp. 5MLIR]
MKWDVEYTDDFGDWWAGLTAEEQESLDTSVRLLEARGPTLGFPHSSGINGSRHSHMRELRTQHDGRPLRTLYAFDPRRSA
ILLIGGDKTGNDRWYDVHVPIADRLYDEHLEQLRKEGLING
MKWDVEYTDDFGDWWAGLTAEEQESLDTSVRLLEARGPTLGFPHSSGINGSRHSHMRELRTQHDGRPLRTLYAFDPRRSA
ILLIGGDKTGNDRWYDVHVPIADRLYDEHLEQLRKEGLING
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|