Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 16998..17682 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP106883 | ||
| Organism | Acidovorax sp. 5MLIR | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M9799_RS20015 | Protein ID | WP_231045138.1 |
| Coordinates | 17317..17682 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M9799_RS20010 | Protein ID | WP_231045137.1 |
| Coordinates | 16998..17324 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9799_RS19990 (M9799_19990) | 12684..13172 | + | 489 | WP_231045134.1 | conjugal transfer protein TrbH | - |
| M9799_RS19995 (M9799_19995) | 13560..14501 | + | 942 | WP_263726283.1 | TrbI/VirB10 family protein | - |
| M9799_RS20000 (M9799_20000) | 14555..15541 | - | 987 | Protein_19 | DUF4238 domain-containing protein | - |
| M9799_RS20005 (M9799_20005) | 15711..16019 | - | 309 | WP_231045136.1 | H-NS histone family protein | - |
| M9799_RS20010 (M9799_20010) | 16998..17324 | - | 327 | WP_231045137.1 | XRE family transcriptional regulator | Antitoxin |
| M9799_RS20015 (M9799_20015) | 17317..17682 | - | 366 | WP_231045138.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9799_RS20020 (M9799_20020) | 17830..18273 | + | 444 | WP_231045149.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| M9799_RS20025 (M9799_20025) | 18276..18404 | + | 129 | Protein_24 | DNA polymerase V subunit UmuC | - |
| M9799_RS20030 (M9799_20030) | 18590..19789 | - | 1200 | WP_231045139.1 | MFS transporter | - |
| M9799_RS20035 (M9799_20035) | 19802..20494 | - | 693 | WP_255662852.1 | arsenical resistance protein ArsH | - |
| M9799_RS20040 (M9799_20040) | 20505..20936 | - | 432 | WP_231045141.1 | arsenate reductase (glutaredoxin) | - |
| M9799_RS20045 (M9799_20045) | 20962..22251 | - | 1290 | WP_231045142.1 | arsenic transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..131045 | 131045 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13931.43 Da Isoelectric Point: 5.5367
>T259927 WP_231045138.1 NZ_CP106883:c17682-17317 [Acidovorax sp. 5MLIR]
MKWDVEYTDDFGDWWAGLTAEEQESLDTSVRLLEARGPTLGFPHSSGINGSRHSHMRELRTQHDGRPLRTLYAFDPRRSA
ILLIGGDKTGNDRWYDVHVPIADRLYDEHLEQLRKEGLING
MKWDVEYTDDFGDWWAGLTAEEQESLDTSVRLLEARGPTLGFPHSSGINGSRHSHMRELRTQHDGRPLRTLYAFDPRRSA
ILLIGGDKTGNDRWYDVHVPIADRLYDEHLEQLRKEGLING
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|