Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1964652..1965303 | Replicon | chromosome |
| Accession | NZ_CP106852 | ||
| Organism | Edwardsiella ictaluri strain E9-302 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N8I67_RS09295 | Protein ID | WP_198077054.1 |
| Coordinates | 1964953..1965303 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2A7U2K2 |
| Locus tag | N8I67_RS09290 | Protein ID | WP_049640646.1 |
| Coordinates | 1964652..1964951 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I67_RS09260 (N8I67_09260) | 1960229..1961569 | - | 1341 | WP_049640648.1 | Fic family protein | - |
| N8I67_RS09265 (N8I67_09265) | 1961698..1962468 | - | 771 | WP_198077052.1 | Rha family transcriptional regulator | - |
| N8I67_RS09270 (N8I67_09270) | 1962875..1963252 | + | 378 | WP_233420345.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| N8I67_RS09275 (N8I67_09275) | 1963242..1963550 | + | 309 | WP_015871333.1 | helix-turn-helix transcriptional regulator | - |
| N8I67_RS09280 (N8I67_09280) | 1963801..1964058 | + | 258 | WP_198077053.1 | DUF4160 domain-containing protein | - |
| N8I67_RS09285 (N8I67_09285) | 1964068..1964580 | + | 513 | WP_015871334.1 | DUF2442 domain-containing protein | - |
| N8I67_RS09290 (N8I67_09290) | 1964652..1964951 | - | 300 | WP_049640646.1 | XRE family transcriptional regulator | Antitoxin |
| N8I67_RS09295 (N8I67_09295) | 1964953..1965303 | - | 351 | WP_198077054.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8I67_RS09300 (N8I67_09300) | 1965353..1965664 | - | 312 | WP_049640644.1 | DUF1364 family protein | - |
| N8I67_RS09305 (N8I67_09305) | 1965667..1966311 | - | 645 | WP_198077055.1 | DUF1367 family protein | - |
| N8I67_RS09310 (N8I67_09310) | 1966421..1966768 | - | 348 | WP_015871339.1 | hypothetical protein | - |
| N8I67_RS09315 (N8I67_09315) | 1966798..1968180 | - | 1383 | WP_049640642.1 | replicative DNA helicase | - |
| N8I67_RS09320 (N8I67_09320) | 1968177..1969127 | - | 951 | WP_198077056.1 | helix-turn-helix domain-containing protein | - |
| N8I67_RS09325 (N8I67_09325) | 1969131..1969319 | - | 189 | WP_198077057.1 | hypothetical protein | - |
| N8I67_RS09330 (N8I67_09330) | 1969329..1969589 | - | 261 | WP_015871343.1 | hypothetical protein | - |
| N8I67_RS09335 (N8I67_09335) | 1969621..1969851 | - | 231 | WP_198077058.1 | porin | - |
| N8I67_RS09340 (N8I67_09340) | 1969848..1970204 | - | 357 | WP_198077059.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1927647..1985438 | 57791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12907.85 Da Isoelectric Point: 6.9832
>T259906 WP_198077054.1 NZ_CP106852:c1965303-1964953 [Edwardsiella ictaluri]
VWIVETTAAFDEWFTAQSEALQDEMLAALTVLSEFGPNLGRPIVDTLKGAKLANLKELRVQFAGNPIRAFFAFDPERKAI
VLCAGDKTGINEKRFYNSMIKLAEAEFSSHLKKRGS
VWIVETTAAFDEWFTAQSEALQDEMLAALTVLSEFGPNLGRPIVDTLKGAKLANLKELRVQFAGNPIRAFFAFDPERKAI
VLCAGDKTGINEKRFYNSMIKLAEAEFSSHLKKRGS
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|