Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 1964652..1965303 Replicon chromosome
Accession NZ_CP106852
Organism Edwardsiella ictaluri strain E9-302

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag N8I67_RS09295 Protein ID WP_198077054.1
Coordinates 1964953..1965303 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A2A7U2K2
Locus tag N8I67_RS09290 Protein ID WP_049640646.1
Coordinates 1964652..1964951 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8I67_RS09260 (N8I67_09260) 1960229..1961569 - 1341 WP_049640648.1 Fic family protein -
N8I67_RS09265 (N8I67_09265) 1961698..1962468 - 771 WP_198077052.1 Rha family transcriptional regulator -
N8I67_RS09270 (N8I67_09270) 1962875..1963252 + 378 WP_233420345.1 type II toxin-antitoxin system RelE/ParE family toxin -
N8I67_RS09275 (N8I67_09275) 1963242..1963550 + 309 WP_015871333.1 helix-turn-helix transcriptional regulator -
N8I67_RS09280 (N8I67_09280) 1963801..1964058 + 258 WP_198077053.1 DUF4160 domain-containing protein -
N8I67_RS09285 (N8I67_09285) 1964068..1964580 + 513 WP_015871334.1 DUF2442 domain-containing protein -
N8I67_RS09290 (N8I67_09290) 1964652..1964951 - 300 WP_049640646.1 XRE family transcriptional regulator Antitoxin
N8I67_RS09295 (N8I67_09295) 1964953..1965303 - 351 WP_198077054.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N8I67_RS09300 (N8I67_09300) 1965353..1965664 - 312 WP_049640644.1 DUF1364 family protein -
N8I67_RS09305 (N8I67_09305) 1965667..1966311 - 645 WP_198077055.1 DUF1367 family protein -
N8I67_RS09310 (N8I67_09310) 1966421..1966768 - 348 WP_015871339.1 hypothetical protein -
N8I67_RS09315 (N8I67_09315) 1966798..1968180 - 1383 WP_049640642.1 replicative DNA helicase -
N8I67_RS09320 (N8I67_09320) 1968177..1969127 - 951 WP_198077056.1 helix-turn-helix domain-containing protein -
N8I67_RS09325 (N8I67_09325) 1969131..1969319 - 189 WP_198077057.1 hypothetical protein -
N8I67_RS09330 (N8I67_09330) 1969329..1969589 - 261 WP_015871343.1 hypothetical protein -
N8I67_RS09335 (N8I67_09335) 1969621..1969851 - 231 WP_198077058.1 porin -
N8I67_RS09340 (N8I67_09340) 1969848..1970204 - 357 WP_198077059.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1927647..1985438 57791


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-107)

Antitoxin

Cro/C1-type helix-turn-helix domain

(32-80)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12907.85 Da        Isoelectric Point: 6.9832

>T259906 WP_198077054.1 NZ_CP106852:c1965303-1964953 [Edwardsiella ictaluri]
VWIVETTAAFDEWFTAQSEALQDEMLAALTVLSEFGPNLGRPIVDTLKGAKLANLKELRVQFAGNPIRAFFAFDPERKAI
VLCAGDKTGINEKRFYNSMIKLAEAEFSSHLKKRGS

Download         Length: 351 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 11037.74 Da        Isoelectric Point: 9.9190

>AT259906 WP_049640646.1 NZ_CP106852:c1964951-1964652 [Edwardsiella ictaluri]
MATLDKLLAQRSPESRAKIEARADELRREVLLHQLREELSMSQSELAAAMGVKQPTVARMEQPDNDPRLSTLKRYVTALG
GQISIDVTLPTGKRVGFHL

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2A7U2K2

References