Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 1962875..1963550 Replicon chromosome
Accession NZ_CP106852
Organism Edwardsiella ictaluri strain E9-302

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag N8I67_RS09270 Protein ID WP_233420345.1
Coordinates 1962875..1963252 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID C5BBM8
Locus tag N8I67_RS09275 Protein ID WP_015871333.1
Coordinates 1963242..1963550 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8I67_RS09235 (N8I67_09235) 1957899..1958246 - 348 WP_035608895.1 phage holin, lambda family -
N8I67_RS09240 (N8I67_09240) 1958330..1958659 - 330 WP_049640650.1 type II toxin-antitoxin system RelE/ParE family toxin -
N8I67_RS09245 (N8I67_09245) 1958634..1958864 - 231 WP_015871327.1 ParD-like family protein -
N8I67_RS09250 (N8I67_09250) 1958996..1959240 - 245 Protein_1781 transposase -
N8I67_RS09255 (N8I67_09255) 1959346..1960164 - 819 WP_198077051.1 hypothetical protein -
N8I67_RS09260 (N8I67_09260) 1960229..1961569 - 1341 WP_049640648.1 Fic family protein -
N8I67_RS09265 (N8I67_09265) 1961698..1962468 - 771 WP_198077052.1 Rha family transcriptional regulator -
N8I67_RS09270 (N8I67_09270) 1962875..1963252 + 378 WP_233420345.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N8I67_RS09275 (N8I67_09275) 1963242..1963550 + 309 WP_015871333.1 helix-turn-helix transcriptional regulator Antitoxin
N8I67_RS09280 (N8I67_09280) 1963801..1964058 + 258 WP_198077053.1 DUF4160 domain-containing protein -
N8I67_RS09285 (N8I67_09285) 1964068..1964580 + 513 WP_015871334.1 DUF2442 domain-containing protein -
N8I67_RS09290 (N8I67_09290) 1964652..1964951 - 300 WP_049640646.1 XRE family transcriptional regulator -
N8I67_RS09295 (N8I67_09295) 1964953..1965303 - 351 WP_198077054.1 type II toxin-antitoxin system RelE/ParE family toxin -
N8I67_RS09300 (N8I67_09300) 1965353..1965664 - 312 WP_049640644.1 DUF1364 family protein -
N8I67_RS09305 (N8I67_09305) 1965667..1966311 - 645 WP_198077055.1 DUF1367 family protein -
N8I67_RS09310 (N8I67_09310) 1966421..1966768 - 348 WP_015871339.1 hypothetical protein -
N8I67_RS09315 (N8I67_09315) 1966798..1968180 - 1383 WP_049640642.1 replicative DNA helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1927647..1985438 57791


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(32-119)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14680.05 Da        Isoelectric Point: 10.1221

>T259904 WP_233420345.1 NZ_CP106852:1962875-1963252 [Edwardsiella ictaluri]
MGKNLRKHNNIVMFHSMNYTIEYYSEEVRLEVDQLPMGMRVRYQHLVERMEIYGSNLGEPHTSPFGDGLFELRIKGSDGI
ARVFYCTLTGKRIVMLHSFIKKTQKTPSAERKKAETRMKEVKHGW

Download         Length: 378 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11207.86 Da        Isoelectric Point: 8.5371

>AT259904 WP_015871333.1 NZ_CP106852:1963242-1963550 [Edwardsiella ictaluri]
MAGKRTPPTMTHDEMAAKWMEDPAFKAEYDAIEEEYALLDEMLAARKNAGLTQAQVAERMGTKATAITRMESNLASGQSG
PSFATLKKFAHATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB C5BBM8

References