Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 1963258..1963933 | Replicon | chromosome |
Accession | NZ_CP106849 | ||
Organism | Edwardsiella ictaluri strain 669 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N8I66_RS09275 | Protein ID | WP_233420345.1 |
Coordinates | 1963258..1963635 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | C5BBM8 |
Locus tag | N8I66_RS09280 | Protein ID | WP_015871333.1 |
Coordinates | 1963625..1963933 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8I66_RS09240 (N8I66_09240) | 1958282..1958629 | - | 348 | WP_035608895.1 | phage holin, lambda family | - |
N8I66_RS09245 (N8I66_09245) | 1958713..1959042 | - | 330 | WP_049640650.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N8I66_RS09250 (N8I66_09250) | 1959017..1959247 | - | 231 | WP_015871327.1 | ParD-like family protein | - |
N8I66_RS09255 (N8I66_09255) | 1959379..1959623 | - | 245 | Protein_1780 | transposase | - |
N8I66_RS09260 (N8I66_09260) | 1959729..1960547 | - | 819 | WP_198077051.1 | hypothetical protein | - |
N8I66_RS09265 (N8I66_09265) | 1960612..1961952 | - | 1341 | WP_049640648.1 | Fic family protein | - |
N8I66_RS09270 (N8I66_09270) | 1962081..1962851 | - | 771 | WP_198077052.1 | Rha family transcriptional regulator | - |
N8I66_RS09275 (N8I66_09275) | 1963258..1963635 | + | 378 | WP_233420345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8I66_RS09280 (N8I66_09280) | 1963625..1963933 | + | 309 | WP_015871333.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N8I66_RS09285 (N8I66_09285) | 1964184..1964441 | + | 258 | WP_198077053.1 | DUF4160 domain-containing protein | - |
N8I66_RS09290 (N8I66_09290) | 1964451..1964963 | + | 513 | WP_015871334.1 | DUF2442 domain-containing protein | - |
N8I66_RS09295 (N8I66_09295) | 1965035..1965334 | - | 300 | WP_049640646.1 | XRE family transcriptional regulator | - |
N8I66_RS09300 (N8I66_09300) | 1965336..1965686 | - | 351 | WP_198077054.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N8I66_RS09305 (N8I66_09305) | 1965736..1966047 | - | 312 | WP_049640644.1 | DUF1364 family protein | - |
N8I66_RS09310 (N8I66_09310) | 1966050..1966694 | - | 645 | WP_198077055.1 | DUF1367 family protein | - |
N8I66_RS09315 (N8I66_09315) | 1966804..1967151 | - | 348 | WP_015871339.1 | hypothetical protein | - |
N8I66_RS09320 (N8I66_09320) | 1967181..1968563 | - | 1383 | WP_049640642.1 | replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1928030..1985821 | 57791 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14680.05 Da Isoelectric Point: 10.1221
>T259896 WP_233420345.1 NZ_CP106849:1963258-1963635 [Edwardsiella ictaluri]
MGKNLRKHNNIVMFHSMNYTIEYYSEEVRLEVDQLPMGMRVRYQHLVERMEIYGSNLGEPHTSPFGDGLFELRIKGSDGI
ARVFYCTLTGKRIVMLHSFIKKTQKTPSAERKKAETRMKEVKHGW
MGKNLRKHNNIVMFHSMNYTIEYYSEEVRLEVDQLPMGMRVRYQHLVERMEIYGSNLGEPHTSPFGDGLFELRIKGSDGI
ARVFYCTLTGKRIVMLHSFIKKTQKTPSAERKKAETRMKEVKHGW
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|