Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 5929..6442 Replicon plasmid pAH6072_1
Accession NZ_CP106835
Organism Staphylococcus epidermidis strain AH6072

Toxin (Protein)


Gene name yoeB Uniprot ID A0A8B5RSL6
Locus tag N8145_RS11735 Protein ID WP_024054463.1
Coordinates 5929..6195 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A8B5RQB4
Locus tag N8145_RS11740 Protein ID WP_002452575.1
Coordinates 6188..6442 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8145_RS11685 (N8145_11685) 1148..1327 + 180 WP_002456267.1 CsbD family protein -
N8145_RS11690 (N8145_11690) 1360..1506 - 147 WP_227946810.1 YolD-like family protein -
N8145_RS11695 (N8145_11695) 1520..1759 - 240 WP_227946811.1 YolD-like family protein -
N8145_RS11700 (N8145_11700) 1922..2179 + 258 WP_002441972.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
N8145_RS11705 (N8145_11705) 2179..2445 + 267 WP_029376511.1 Txe/YoeB family addiction module toxin -
N8145_RS11710 (N8145_11710) 2462..2632 + 171 WP_171049635.1 hypothetical protein -
N8145_RS11715 (N8145_11715) 2691..3218 + 528 WP_080280668.1 cellulase family glycosylhydrolase -
N8145_RS11720 (N8145_11720) 3719..4075 - 357 WP_002441965.1 hypothetical protein -
N8145_RS11725 (N8145_11725) 4389..4937 + 549 WP_029376510.1 recombinase family protein -
N8145_RS11730 (N8145_11730) 5306..5731 + 426 WP_229381335.1 CPBP family intramembrane metalloprotease -
N8145_RS11735 (N8145_11735) 5929..6195 - 267 WP_024054463.1 Txe/YoeB family addiction module toxin Toxin
N8145_RS11740 (N8145_11740) 6188..6442 - 255 WP_002452575.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N8145_RS11745 (N8145_11745) 6906..8084 + 1179 WP_263267136.1 IS110-like element ISSep2 family transposase -
N8145_RS11750 (N8145_11750) 8604..9101 - 498 WP_049374138.1 hypothetical protein -
N8145_RS11755 (N8145_11755) 10578..11138 - 561 WP_029376507.1 TIGR00730 family Rossman fold protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..43056 43056
- flank IS/Tn - - 7011..8084 1073


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(4-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10481.13 Da        Isoelectric Point: 9.9964

>T259875 WP_024054463.1 NZ_CP106835:c6195-5929 [Staphylococcus epidermidis]
MNKYNITFTPTAFEDYKYWQTQDKKLLKKINSLIKSIQRDGILEGEGKAEPLKGNLKGYYSRRINHEHRLVYTIKDPSII
IIACRYHY

Download         Length: 267 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9651.68 Da        Isoelectric Point: 4.1237

>AT259875 WP_002452575.1 NZ_CP106835:c6442-6188 [Staphylococcus epidermidis]
MTVLTYSNARKDFRKLIDKVNDDSDTVTITTNDRNAVLISEDDYNSIMETLYLQQSPVNAKRLAQSMEEAERVNTVEVDI
TTYE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B5RSL6

Antitoxin

Source ID Structure
AlphaFold DB A0A8B5RQB4

References