Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 1922..2445 Replicon plasmid pAH6072_1
Accession NZ_CP106835
Organism Staphylococcus epidermidis strain AH6072

Toxin (Protein)


Gene name yoeB Uniprot ID A0A8B5RPI4
Locus tag N8145_RS11705 Protein ID WP_029376511.1
Coordinates 2179..2445 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID C5QR06
Locus tag N8145_RS11700 Protein ID WP_002441972.1
Coordinates 1922..2179 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8145_RS11680 (N8145_11680) 605..751 - 147 WP_002441983.1 hypothetical protein -
N8145_RS11685 (N8145_11685) 1148..1327 + 180 WP_002456267.1 CsbD family protein -
N8145_RS11690 (N8145_11690) 1360..1506 - 147 WP_227946810.1 YolD-like family protein -
N8145_RS11695 (N8145_11695) 1520..1759 - 240 WP_227946811.1 YolD-like family protein -
N8145_RS11700 (N8145_11700) 1922..2179 + 258 WP_002441972.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N8145_RS11705 (N8145_11705) 2179..2445 + 267 WP_029376511.1 Txe/YoeB family addiction module toxin Toxin
N8145_RS11710 (N8145_11710) 2462..2632 + 171 WP_171049635.1 hypothetical protein -
N8145_RS11715 (N8145_11715) 2691..3218 + 528 WP_080280668.1 cellulase family glycosylhydrolase -
N8145_RS11720 (N8145_11720) 3719..4075 - 357 WP_002441965.1 hypothetical protein -
N8145_RS11725 (N8145_11725) 4389..4937 + 549 WP_029376510.1 recombinase family protein -
N8145_RS11730 (N8145_11730) 5306..5731 + 426 WP_229381335.1 CPBP family intramembrane metalloprotease -
N8145_RS11735 (N8145_11735) 5929..6195 - 267 WP_024054463.1 Txe/YoeB family addiction module toxin -
N8145_RS11740 (N8145_11740) 6188..6442 - 255 WP_002452575.1 type II toxin-antitoxin system Phd/YefM family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..43056 43056
- flank IS/Tn - - 7011..8084 1073


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-67)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10721.38 Da        Isoelectric Point: 10.3481

>T259874 WP_029376511.1 NZ_CP106835:2179-2445 [Staphylococcus epidermidis]
MAKYKINIKNSAKTDLKKIKRSHLQEQFLKIVEILKYNPYQQSQSFEKLHPKHLGRYSRRINHQHRVVYTIDEENKEVLI
LATWSHYE

Download         Length: 267 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10041.10 Da        Isoelectric Point: 4.5610

>AT259874 WP_002441972.1 NZ_CP106835:1922-2179 [Staphylococcus epidermidis]
MKSKTPTEARKDFYQLLKRVNNDHEPVYIEGKYDESNAVIIGMEDWRSINETIYLEATGTMDKVREREHDNSGYTNIDDI
DWARL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B5RPI4

Antitoxin

Source ID Structure
AlphaFold DB A0A8B5RUG0

References