Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 939420..940222 | Replicon | chromosome |
Accession | NZ_CP106834 | ||
Organism | Staphylococcus epidermidis strain AH6072 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | Q5HN83 |
Locus tag | N8145_RS04545 | Protein ID | WP_002468490.1 |
Coordinates | 940043..940222 (+) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | A0A8B5RW65 |
Locus tag | N8145_RS04540 | Protein ID | WP_002470400.1 |
Coordinates | 939420..940019 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8145_RS04515 (N8145_04515) | 934631..936088 | + | 1458 | WP_002470402.1 | ABC transporter substrate-binding protein/permease | - |
N8145_RS04520 (N8145_04520) | 936081..936803 | + | 723 | WP_001829838.1 | amino acid ABC transporter ATP-binding protein | - |
N8145_RS04525 (N8145_04525) | 937318..937455 | + | 138 | WP_064783702.1 | hypothetical protein | - |
N8145_RS04530 (N8145_04530) | 937665..938795 | + | 1131 | WP_002470398.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
N8145_RS04535 (N8145_04535) | 938792..939262 | + | 471 | WP_001829836.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
N8145_RS04540 (N8145_04540) | 939420..940019 | + | 600 | WP_002470400.1 | hypothetical protein | Antitoxin |
N8145_RS04545 (N8145_04545) | 940043..940222 | + | 180 | WP_002468490.1 | SAS053 family protein | Toxin |
N8145_RS04550 (N8145_04550) | 940378..940782 | + | 405 | WP_001829818.1 | hypothetical protein | - |
N8145_RS04555 (N8145_04555) | 940967..942352 | + | 1386 | WP_001829862.1 | class II fumarate hydratase | - |
N8145_RS04560 (N8145_04560) | 942713..943537 | - | 825 | WP_001829804.1 | RluA family pseudouridine synthase | - |
N8145_RS04565 (N8145_04565) | 943696..944829 | + | 1134 | WP_001829819.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 937300..937455 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6963.56 Da Isoelectric Point: 4.3016
>T259871 WP_002468490.1 NZ_CP106834:940043-940222 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDLKKQ
Download Length: 180 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22699.58 Da Isoelectric Point: 4.9942
>AT259871 WP_002470400.1 NZ_CP106834:939420-940019 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLSEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEHAPVFDELKKNVENHTVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLSEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HY44 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B5RW65 |