Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3940703..3941300 | Replicon | chromosome |
| Accession | NZ_CP106786 | ||
| Organism | Klebsiella pneumoniae strain KP1161 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A9J6S5A1 |
| Locus tag | N9H76_RS19365 | Protein ID | WP_004893639.1 |
| Coordinates | 3940983..3941300 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | N9H76_RS19360 | Protein ID | WP_004142561.1 |
| Coordinates | 3940703..3940990 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N9H76_RS19330 (N9H76_19330) | 3936783..3937031 | + | 249 | WP_032410665.1 | DUF1158 domain-containing protein | - |
| N9H76_RS19335 (N9H76_19335) | 3937049..3937390 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| N9H76_RS19340 (N9H76_19340) | 3937421..3938536 | - | 1116 | WP_075210499.1 | MBL fold metallo-hydrolase | - |
| N9H76_RS19345 (N9H76_19345) | 3938716..3939297 | + | 582 | WP_032410661.1 | TetR/AcrR family transcriptional regulator | - |
| N9H76_RS19350 (N9H76_19350) | 3939297..3939665 | + | 369 | WP_032421096.1 | MmcQ/YjbR family DNA-binding protein | - |
| N9H76_RS19355 (N9H76_19355) | 3939785..3940438 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| N9H76_RS19360 (N9H76_19360) | 3940703..3940990 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N9H76_RS19365 (N9H76_19365) | 3940983..3941300 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N9H76_RS19370 (N9H76_19370) | 3941485..3942528 | - | 1044 | WP_032410657.1 | DUF2157 domain-containing protein | - |
| N9H76_RS19375 (N9H76_19375) | 3943194..3944060 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| N9H76_RS19380 (N9H76_19380) | 3944169..3945596 | + | 1428 | WP_114271149.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T259823 WP_004893639.1 NZ_CP106786:c3941300-3940983 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|