Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 356149..356795 | Replicon | chromosome |
Accession | NZ_CP106786 | ||
Organism | Klebsiella pneumoniae strain KP1161 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N9H76_RS01655 | Protein ID | WP_023317328.1 |
Coordinates | 356149..356496 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N9H76_RS01660 | Protein ID | WP_032412314.1 |
Coordinates | 356496..356795 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9H76_RS01645 (N9H76_01645) | 352075..353508 | + | 1434 | WP_021312823.1 | glycogen synthase GlgA | - |
N9H76_RS01650 (N9H76_01650) | 353526..355973 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
N9H76_RS01655 (N9H76_01655) | 356149..356496 | + | 348 | WP_023317328.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N9H76_RS01660 (N9H76_01660) | 356496..356795 | + | 300 | WP_032412314.1 | XRE family transcriptional regulator | Antitoxin |
N9H76_RS01665 (N9H76_01665) | 356858..358366 | - | 1509 | WP_032412313.1 | glycerol-3-phosphate dehydrogenase | - |
N9H76_RS01670 (N9H76_01670) | 358571..358900 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
N9H76_RS01675 (N9H76_01675) | 358951..359781 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
N9H76_RS01680 (N9H76_01680) | 359831..360589 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13562.60 Da Isoelectric Point: 6.2327
>T259813 WP_023317328.1 NZ_CP106786:356149-356496 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
ILCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
ILCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|