Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 329960..330546 Replicon chromosome
Accession NZ_CP106786
Organism Klebsiella pneumoniae strain KP1161

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag N9H76_RS01545 Protein ID WP_002920800.1
Coordinates 330178..330546 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag N9H76_RS01540 Protein ID WP_004174006.1
Coordinates 329960..330181 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N9H76_RS01520 (N9H76_01520) 326117..327043 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N9H76_RS01525 (N9H76_01525) 327040..328317 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
N9H76_RS01530 (N9H76_01530) 328314..329081 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N9H76_RS01535 (N9H76_01535) 329083..329796 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N9H76_RS01540 (N9H76_01540) 329960..330181 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N9H76_RS01545 (N9H76_01545) 330178..330546 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N9H76_RS01550 (N9H76_01550) 330819..332135 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N9H76_RS01555 (N9H76_01555) 332242..333129 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N9H76_RS01560 (N9H76_01560) 333126..333971 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N9H76_RS01565 (N9H76_01565) 333973..335043 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 327040..335780 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T259812 WP_002920800.1 NZ_CP106786:330178-330546 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT259812 WP_004174006.1 NZ_CP106786:329960-330181 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References