Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1163023..1163696 | Replicon | chromosome |
Accession | NZ_CP106785 | ||
Organism | Pseudomonas tohonis strain G5.110 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | N9L84_RS05500 | Protein ID | WP_263154402.1 |
Coordinates | 1163427..1163696 (-) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | N9L84_RS05495 | Protein ID | WP_263152831.1 |
Coordinates | 1163023..1163424 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N9L84_RS05470 (N9L84_05470) | 1158596..1158853 | - | 258 | WP_263152822.1 | hypothetical protein | - |
N9L84_RS05475 (N9L84_05475) | 1159302..1159778 | - | 477 | WP_263152823.1 | hypothetical protein | - |
N9L84_RS05480 (N9L84_05480) | 1159765..1160163 | - | 399 | WP_263152825.1 | hypothetical protein | - |
N9L84_RS05485 (N9L84_05485) | 1160227..1161408 | - | 1182 | WP_263152827.1 | hypothetical protein | - |
N9L84_RS05490 (N9L84_05490) | 1161423..1162538 | - | 1116 | WP_263152829.1 | nucleoid-associated protein | - |
N9L84_RS05495 (N9L84_05495) | 1163023..1163424 | - | 402 | WP_263152831.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
N9L84_RS05500 (N9L84_05500) | 1163427..1163696 | - | 270 | WP_263154402.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
N9L84_RS05505 (N9L84_05505) | 1163797..1164750 | - | 954 | WP_263152832.1 | tyrosine-type recombinase/integrase | - |
N9L84_RS05510 (N9L84_05510) | 1164740..1165594 | - | 855 | WP_263152834.1 | hypothetical protein | - |
N9L84_RS05515 (N9L84_05515) | 1165597..1166346 | - | 750 | WP_263152836.1 | IS21-like element helper ATPase IstB | - |
N9L84_RS05520 (N9L84_05520) | 1166339..1167883 | - | 1545 | WP_263152838.1 | IS21 family transposase | - |
N9L84_RS05525 (N9L84_05525) | 1168149..1168451 | - | 303 | WP_263152840.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 9540.00 Da Isoelectric Point: 4.6062
>T259803 WP_263154402.1 NZ_CP106785:c1163696-1163427 [Pseudomonas tohonis]
MTVVKALVAAGNVRSTMSALTGGAALGFDFEGIVGVVMALAPADFYKSMTTHADHTVWQDVYRTNTEAGEVYLKLTVIDD
VLIVSFKEL
MTVVKALVAAGNVRSTMSALTGGAALGFDFEGIVGVVMALAPADFYKSMTTHADHTVWQDVYRTNTEAGEVYLKLTVIDD
VLIVSFKEL
Download Length: 270 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14366.45 Da Isoelectric Point: 7.0826
>AT259803 WP_263152831.1 NZ_CP106785:c1163424-1163023 [Pseudomonas tohonis]
MKCPSCAAAELVHDTRDLPYTYKNESTTIPAVTGDFCPACGEAVLDAGESTRVSTAMLGFNKQVNASIVDPSFIANVRKK
LALDQREAAEIFGGGVNAFSRYENGKTKPPLALVKLLKVLDRHPELLNEVRTA
MKCPSCAAAELVHDTRDLPYTYKNESTTIPAVTGDFCPACGEAVLDAGESTRVSTAMLGFNKQVNASIVDPSFIANVRKK
LALDQREAAEIFGGGVNAFSRYENGKTKPPLALVKLLKVLDRHPELLNEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|