Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 127610..128036 | Replicon | plasmid pKP0937-2 |
| Accession | NZ_CP106762 | ||
| Organism | Klebsiella pneumoniae strain KP0937 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N8627_RS28770 | Protein ID | WP_001372321.1 |
| Coordinates | 127610..127735 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 127812..128036 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8627_RS28740 (122878) | 122878..123582 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N8627_RS28745 (123863) | 123863..124246 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N8627_RS28750 (124523) | 124523..125170 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| N8627_RS28755 (125467) | 125467..126288 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| N8627_RS28760 (126399) | 126399..126695 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| N8627_RS28765 (126995) | 126995..127291 | + | 297 | Protein_164 | hypothetical protein | - |
| N8627_RS28770 (127610) | 127610..127735 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N8627_RS28775 (127677) | 127677..127826 | - | 150 | Protein_166 | plasmid maintenance protein Mok | - |
| - (127812) | 127812..128036 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (127812) | 127812..128036 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (127812) | 127812..128036 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (127812) | 127812..128036 | - | 225 | NuclAT_0 | - | Antitoxin |
| N8627_RS28780 (128048) | 128048..128767 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| N8627_RS28785 (128764) | 128764..129198 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| N8627_RS28790 (129267) | 129267..131290 | - | 2024 | Protein_169 | ParB/RepB/Spo0J family partition protein | - |
| N8627_RS28795 (131351) | 131351..131584 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| N8627_RS28800 (131642) | 131642..132169 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| N8627_RS28805 (132471) | 132471..132926 | + | 456 | Protein_172 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 / blaSHV-12 | - | 1..134861 | 134861 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T259771 WP_001372321.1 NZ_CP106762:c127735-127610 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT259771 NZ_CP106762:c128036-127812 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
