Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 28898..29151 | Replicon | plasmid pKP0937-2 |
| Accession | NZ_CP106762 | ||
| Organism | Klebsiella pneumoniae strain KP0937 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | N8627_RS28150 | Protein ID | WP_001312851.1 |
| Coordinates | 28898..29047 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 29092..29151 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8627_RS28115 (24257) | 24257..24672 | - | 416 | Protein_34 | IS1 family transposase | - |
| N8627_RS28120 (24921) | 24921..25322 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| N8627_RS28125 (25255) | 25255..25512 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| N8627_RS28130 (25605) | 25605..26258 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| N8627_RS28135 (27197) | 27197..28054 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| N8627_RS28140 (28073) | 28073..28251 | - | 179 | Protein_39 | protein CopA/IncA | - |
| N8627_RS28145 (28366) | 28366..28614 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| N8627_RS28150 (28898) | 28898..29047 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (29092) | 29092..29151 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (29092) | 29092..29151 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (29092) | 29092..29151 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (29092) | 29092..29151 | + | 60 | NuclAT_1 | - | Antitoxin |
| N8627_RS28155 (29352) | 29352..29684 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| N8627_RS28160 (29746) | 29746..30345 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| N8627_RS28165 (30731) | 30731..30931 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| N8627_RS28170 (31063) | 31063..31623 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| N8627_RS28175 (31678) | 31678..32424 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| N8627_RS28180 (32444) | 32444..32644 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| N8627_RS28185 (32669) | 32669..33373 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N8627_RS28190 (33425) | 33425..33769 | + | 345 | Protein_49 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 / blaSHV-12 | - | 1..134861 | 134861 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T259767 WP_001312851.1 NZ_CP106762:c29047-28898 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT259767 NZ_CP106762:29092-29151 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
