Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 125397..126124 | Replicon | plasmid pKP0937-1 |
| Accession | NZ_CP106761 | ||
| Organism | Klebsiella pneumoniae strain KP0937 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | N8627_RS27550 | Protein ID | WP_011251285.1 |
| Coordinates | 125397..125708 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N8627_RS27555 | Protein ID | WP_011251286.1 |
| Coordinates | 125705..126124 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8627_RS27525 (N8627_27525) | 120916..121410 | - | 495 | WP_004212794.1 | thermonuclease family protein | - |
| N8627_RS27530 (N8627_27530) | 121588..121854 | + | 267 | WP_223175074.1 | DUF1173 family protein | - |
| N8627_RS27535 (N8627_27535) | 121887..122537 | + | 651 | WP_068893702.1 | DUF1173 family protein | - |
| N8627_RS27545 (N8627_27545) | 124755..125192 | + | 438 | Protein_133 | DDE-type integrase/transposase/recombinase | - |
| N8627_RS27550 (N8627_27550) | 125397..125708 | + | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| N8627_RS27555 (N8627_27555) | 125705..126124 | + | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| N8627_RS27560 (N8627_27560) | 126271..127239 | + | 969 | WP_074428168.1 | IS5 family transposase | - |
| N8627_RS27565 (N8627_27565) | 127311..127676 | - | 366 | WP_048333448.1 | hypothetical protein | - |
| N8627_RS27570 (N8627_27570) | 127690..128478 | - | 789 | WP_040217257.1 | hypothetical protein | - |
| N8627_RS27575 (N8627_27575) | 128499..129119 | - | 621 | WP_223175004.1 | conjugative transfer protein MobI(A/C) | - |
| N8627_RS27580 (N8627_27580) | 129538..130173 | + | 636 | WP_223171879.1 | hypothetical protein | - |
| N8627_RS27585 (N8627_27585) | 130486..130956 | + | 471 | WP_048333570.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iucA / iucB / iucC / iucD / iutA / rmpA2 / iroN | 1..190869 | 190869 | |
| - | inside | IScluster/Tn | - | - | 108941..133964 | 25023 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T259765 WP_011251285.1 NZ_CP106761:125397-125708 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT259765 WP_011251286.1 NZ_CP106761:125705-126124 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|