Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 746329..747104 | Replicon | chromosome |
| Accession | NZ_CP106760 | ||
| Organism | Klebsiella pneumoniae strain KP0937 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
| Locus tag | N8627_RS03725 | Protein ID | WP_004150910.1 |
| Coordinates | 746619..747104 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | N8627_RS03720 | Protein ID | WP_004150912.1 |
| Coordinates | 746329..746622 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8627_RS03700 (N8627_03700) | 741537..742139 | - | 603 | WP_062954968.1 | short chain dehydrogenase | - |
| N8627_RS03705 (N8627_03705) | 742237..743148 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
| N8627_RS03710 (N8627_03710) | 743149..744297 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
| N8627_RS03715 (N8627_03715) | 744308..745684 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
| N8627_RS03720 (N8627_03720) | 746329..746622 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| N8627_RS03725 (N8627_03725) | 746619..747104 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
| N8627_RS03730 (N8627_03730) | 747808..748401 | + | 594 | WP_004188553.1 | hypothetical protein | - |
| N8627_RS03735 (N8627_03735) | 748498..748714 | + | 217 | Protein_734 | transposase | - |
| N8627_RS03740 (N8627_03740) | 749320..750192 | + | 873 | WP_004188557.1 | ParA family protein | - |
| N8627_RS03745 (N8627_03745) | 750192..750575 | + | 384 | WP_004150906.1 | hypothetical protein | - |
| N8627_RS03750 (N8627_03750) | 750568..751935 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 748498..748650 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T259750 WP_004150910.1 NZ_CP106760:746619-747104 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q4Q548 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |