Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 354089..354735 | Replicon | chromosome |
| Accession | NZ_CP106760 | ||
| Organism | Klebsiella pneumoniae strain KP0937 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | W8UNE1 |
| Locus tag | N8627_RS01635 | Protein ID | WP_002920560.1 |
| Coordinates | 354089..354436 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | N8627_RS01640 | Protein ID | WP_002920557.1 |
| Coordinates | 354436..354735 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8627_RS01625 (N8627_01625) | 350015..351448 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| N8627_RS01630 (N8627_01630) | 351466..353913 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| N8627_RS01635 (N8627_01635) | 354089..354436 | + | 348 | WP_002920560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8627_RS01640 (N8627_01640) | 354436..354735 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N8627_RS01645 (N8627_01645) | 354798..356306 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| N8627_RS01650 (N8627_01650) | 356511..356840 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| N8627_RS01655 (N8627_01655) | 356891..357721 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| N8627_RS01660 (N8627_01660) | 357771..358529 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13502.56 Da Isoelectric Point: 6.2300
>T259749 WP_002920560.1 NZ_CP106760:354089-354436 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRACFAFDPLRKAI
VLCVGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBY5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBF8 |