259745

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 2761110..2761644 Replicon chromosome
Accession NZ_CP106757
Organism Enterococcus faecalis strain NY13410

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag N8I78_RS13185 Protein ID WP_002360769.1
Coordinates 2761110..2761385 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag N8I78_RS13190 Protein ID WP_002369771.1
Coordinates 2761378..2761644 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8I78_RS13155 (2756282) 2756282..2756467 - 186 WP_002358660.1 hypothetical protein -
N8I78_RS13160 (2756497) 2756497..2756826 + 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
N8I78_RS13165 (2756954) 2756954..2757892 + 939 WP_002370935.1 2-dehydropantoate 2-reductase -
N8I78_RS13170 (2757918) 2757918..2758955 + 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
N8I78_RS13175 (2759260) 2759260..2760154 - 895 Protein_2585 IS256 family transposase -
N8I78_RS13180 (2760275) 2760275..2760919 + 645 WP_002377952.1 IS6 family transposase -
N8I78_RS13185 (2761110) 2761110..2761385 - 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
N8I78_RS13190 (2761378) 2761378..2761644 - 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
N8I78_RS13195 (2761755) 2761755..2762339 - 585 WP_002377949.1 thermonuclease family protein -
N8I78_RS13200 (2762363) 2762363..2762779 - 417 WP_010710134.1 single-stranded DNA-binding protein -
N8I78_RS13205 (2762855) 2762855..2763103 - 249 WP_002360773.1 DUF3850 domain-containing protein -
N8I78_RS13210 (2763116) 2763116..2763616 - 501 WP_002360775.1 DnaJ domain-containing protein -
N8I78_RS13215 (2763649) 2763649..2763915 - 267 WP_002377947.1 hypothetical protein -
N8I78_RS13220 (2764507) 2764507..2764995 - 489 WP_010710133.1 hypothetical protein -
N8I78_RS13225 (2765001) 2765001..2765594 - 594 WP_002414802.1 replication-relaxation family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - esp / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 / bsh 2718000..2781254 63254


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T259745 WP_002360769.1 NZ_CP106757:c2761385-2761110 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT259745 WP_002369771.1 NZ_CP106757:c2761644-2761378 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References