Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-DinJ |
| Location | 2761110..2761644 | Replicon | chromosome |
| Accession | NZ_CP106757 | ||
| Organism | Enterococcus faecalis strain NY13410 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R3JX52 |
| Locus tag | N8I78_RS13185 | Protein ID | WP_002360769.1 |
| Coordinates | 2761110..2761385 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | R3H6P0 |
| Locus tag | N8I78_RS13190 | Protein ID | WP_002369771.1 |
| Coordinates | 2761378..2761644 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I78_RS13155 (2756282) | 2756282..2756467 | - | 186 | WP_002358660.1 | hypothetical protein | - |
| N8I78_RS13160 (2756497) | 2756497..2756826 | + | 330 | WP_002358661.1 | LPXTG cell wall anchor domain-containing protein | - |
| N8I78_RS13165 (2756954) | 2756954..2757892 | + | 939 | WP_002370935.1 | 2-dehydropantoate 2-reductase | - |
| N8I78_RS13170 (2757918) | 2757918..2758955 | + | 1038 | WP_002355369.1 | PTS sugar transporter subunit IIC | - |
| N8I78_RS13175 (2759260) | 2759260..2760154 | - | 895 | Protein_2585 | IS256 family transposase | - |
| N8I78_RS13180 (2760275) | 2760275..2760919 | + | 645 | WP_002377952.1 | IS6 family transposase | - |
| N8I78_RS13185 (2761110) | 2761110..2761385 | - | 276 | WP_002360769.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| N8I78_RS13190 (2761378) | 2761378..2761644 | - | 267 | WP_002369771.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N8I78_RS13195 (2761755) | 2761755..2762339 | - | 585 | WP_002377949.1 | thermonuclease family protein | - |
| N8I78_RS13200 (2762363) | 2762363..2762779 | - | 417 | WP_010710134.1 | single-stranded DNA-binding protein | - |
| N8I78_RS13205 (2762855) | 2762855..2763103 | - | 249 | WP_002360773.1 | DUF3850 domain-containing protein | - |
| N8I78_RS13210 (2763116) | 2763116..2763616 | - | 501 | WP_002360775.1 | DnaJ domain-containing protein | - |
| N8I78_RS13215 (2763649) | 2763649..2763915 | - | 267 | WP_002377947.1 | hypothetical protein | - |
| N8I78_RS13220 (2764507) | 2764507..2764995 | - | 489 | WP_010710133.1 | hypothetical protein | - |
| N8I78_RS13225 (2765001) | 2765001..2765594 | - | 594 | WP_002414802.1 | replication-relaxation family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Integrative and Conjugative Element | - | esp / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 / bsh | 2718000..2781254 | 63254 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10732.58 Da Isoelectric Point: 9.6918
>T259745 WP_002360769.1 NZ_CP106757:c2761385-2761110 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AEA7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AED7 |