Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 634430..635125 | Replicon | chromosome |
Accession | NZ_CP106757 | ||
Organism | Enterococcus faecalis strain NY13410 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | N8I78_RS03005 | Protein ID | WP_002385632.1 |
Coordinates | 634430..634774 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | N8I78_RS03010 | Protein ID | WP_002385633.1 |
Coordinates | 634793..635125 (-) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8I78_RS02985 (629795) | 629795..631930 | + | 2136 | WP_010706862.1 | penicillin-binding protein 2 | - |
N8I78_RS02990 (632056) | 632056..632205 | + | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
N8I78_RS02995 (632308) | 632308..633489 | - | 1182 | WP_010714109.1 | site-specific integrase | - |
N8I78_RS03000 (633644) | 633644..634372 | - | 729 | WP_002385631.1 | potassium channel family protein | - |
N8I78_RS03005 (634430) | 634430..634774 | - | 345 | WP_002385632.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
N8I78_RS03010 (634793) | 634793..635125 | - | 333 | WP_002385633.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N8I78_RS03015 (635431) | 635431..635640 | + | 210 | WP_002415277.1 | DUF2829 domain-containing protein | - |
N8I78_RS03020 (635637) | 635637..636020 | - | 384 | WP_002385635.1 | DUF2513 domain-containing protein | - |
N8I78_RS03025 (636104) | 636104..636280 | + | 177 | WP_002385636.1 | helix-turn-helix transcriptional regulator | - |
N8I78_RS03030 (636296) | 636296..636424 | + | 129 | WP_002385637.1 | hypothetical protein | - |
N8I78_RS03035 (636405) | 636405..636719 | - | 315 | WP_002385638.1 | hypothetical protein | - |
N8I78_RS03040 (636795) | 636795..637064 | + | 270 | WP_002385641.1 | hypothetical protein | - |
N8I78_RS03045 (637100) | 637100..637279 | + | 180 | WP_010785685.1 | hypothetical protein | - |
N8I78_RS03050 (637346) | 637346..637645 | + | 300 | WP_002385643.1 | hypothetical protein | - |
N8I78_RS03055 (637642) | 637642..637866 | + | 225 | WP_002370012.1 | hypothetical protein | - |
N8I78_RS03060 (637969) | 637969..638985 | + | 1017 | WP_002393794.1 | RecT family recombinase | - |
N8I78_RS03065 (638948) | 638948..639763 | + | 816 | WP_002393795.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 632308..680573 | 48265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13594.61 Da Isoelectric Point: 5.6229
>T259743 WP_002385632.1 NZ_CP106757:c634774-634430 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKEHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKEHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|